KEGG   Nocardia farcinica IFM 10152: NFA_52750Help
Entry
NFA_52750         CDS       T00207                                 

Gene name
groEL2
Definition
(GenBank) putative chaperonin GroEL
  KO
K04077  chaperonin GroEL
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NFA_52750 (groEL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nfa03019]
    NFA_52750 (groEL2)
   03110 Chaperones and folding catalysts [BR:nfa03110]
    NFA_52750 (groEL2)
   03029 Mitochondrial biogenesis [BR:nfa03029]
    NFA_52750 (groEL2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfa04147]
    NFA_52750 (groEL2)
Messenger RNA biogenesis [BR:nfa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     NFA_52750 (groEL2)
Chaperones and folding catalysts [BR:nfa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   NFA_52750 (groEL2)
Mitochondrial biogenesis [BR:nfa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    NFA_52750 (groEL2)
Exosome [BR:nfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NFA_52750 (groEL2)
  Exosomal proteins of other body fluids (saliva and urine)
   NFA_52750 (groEL2)
  Exosomal proteins of breast cancer cells
   NFA_52750 (groEL2)
  Exosomal proteins of colorectal cancer cells
   NFA_52750 (groEL2)
  Exosomal proteins of bladder cancer cells
   NFA_52750 (groEL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-ProteinID: BAD60127
NIH_Japan: nfa52750
UniProt: Q9AFA6
Position
complement(5576327..5577952)
Genome map
AA seq 541 aa AA seqDB search
MAKTIAYDEEARRGLERGLNSLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIE
LEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIE
KAVEAVTAKLLDTAKEVETKEQIAATAGISAGDASIGELIAEAMDKVGKEGVITVEESNT
FGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVGSKVSTVKDLLPLLEKVIQ
AGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAQLADIAILTGGEVIS
EEVGLSLETAGIELLGQARKVVVTKDETTIVEGAGDAEAIKGRVAQIRTEIENSDSDYDR
EKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALLQA
APALDELKLTGDEATGANIVRVALSAPLKQIAFNAGLEPGVVAEKVSNLEAGHGLNADSG
EYEDLLAAGVADPVKVTRSALQNAASIAALFLTTEAVVADKPEKAAAPAGDPTGGMGGMD
F
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacaattgcgtatgacgaagaggcccgccgcggcctcgagcgcggtctgaac
agcctcgccgacgcggtcaaggtgacgctgggccccaagggtcgcaacgttgtcctggag
aagaagtggggcgcccccacgatcaccaacgatggtgtgtccatcgccaaggagatcgag
ctggaggatccctacgagaagatcggcgccgagctggtcaaggaagtcgccaagaagacc
gacgacgtcgcgggcgacggcaccaccaccgccaccgtgctcgcccaggcgctggtgcgc
gagggtctgcgcaacgtggccgcgggcgcgaacccgctgggcctcaagcgcggcatcgag
aaggccgtcgaggccgtgaccgccaagctgctcgacaccgccaaggaggtcgagaccaag
gagcagatcgccgccaccgcgggcatctccgcgggcgacgcgtccatcggtgagctgatc
gccgaggccatggacaaggtcggcaaggaaggcgtcatcaccgtcgaggagagcaacacc
ttcggcctccagctggagctgaccgagggcatgcgcttcgacaagggctacatctccggc
tacttcgtgaccgatcccgagcgtcaggaagcggtcctcgaggatccctacatcctgctc
gtcggctcgaaggtctccaccgtcaaggacctgctgccgctgctggagaaggtcatccag
gccggcaagccgctgctgatcatcgccgaggacgtcgagggcgaggccctgtcgaccctg
gtcgtgaacaagatccgtggcaccttcaagtccgtcgccgtcaaggccccgggcttcggt
gaccgccgcaaggctcagctggccgacatcgccatcctgaccggtggcgaggtcatcagc
gaagaggtcggcctctcgctggagaccgcgggcatcgagctgctcggccaggctcgcaag
gtcgtcgtgaccaaggacgagaccaccatcgtcgagggcgcgggcgacgccgaggcgatc
aagggccgggtcgcgcagatccgcaccgagatcgagaactccgactccgactacgaccgc
gagaagctgcaggagcggctggccaagctggccggcggcgtggccgtcatcaaggcgggc
gcggccaccgaggtcgagctcaaggagcgcaagcaccgcatcgaggacgccgtccgcaac
gcgaaggccgccgtcgaggagggcatcgtcgccggtggtggcgtggccctgctgcaggcc
gccccggccctggacgagctgaagctgaccggtgacgaggccaccggcgcgaacatcgtg
cgcgtcgctctctcggctccgctgaagcagatcgccttcaacgccggcctcgagcccggc
gtggtcgccgagaaggtctcgaacctggaggccggccacggcctgaacgccgactcgggc
gagtacgaggacctgctggccgccggcgtcgccgacccggtcaaggtcacccgctcggcg
ctgcagaacgcggcctccatcgcggccctgttcctcaccaccgaggccgtcgtcgccgac
aagccggagaaggccgccgctcccgccggcgacccgaccggtggcatgggcggcatggac
ttctga

DBGET integrated database retrieval system