KEGG   Aspergillus fischeri: NFIA_009150Help
Entry
NFIA_009150       CDS       T01070                                 

Definition
(RefSeq) ATP dependent RNA helicase (Rok1), putative
  KO
K14779  ATP-dependent RNA helicase DDX52/ROK1 [EC:3.6.4.13]
Organism
nfi  Aspergillus fischeri
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nfi03009]
    NFIA_009150
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     NFIA_009150
Ribosome biogenesis [BR:nfi03009]
 Eukaryotic type
  90S particles
   Helicases
    NFIA_009150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII PBP1_TM
Motif
Other DBs
NCBI-GeneID: 4591949
NCBI-ProteinID: XP_001264133
UniProt: A1D1E3
AA seq 738 aa AA seqDB search
MDAFKLLTRATKLKGGAAPSSAQSSTRLPSTGKAANPQLFRSSEADKVLEEARHGKKRKR
VAGPEAAESDDDGAELNFFGSSKARRSSASMAKEQEKEQQEQQEHRDDTSDADDADEMDE
VQCRTVLNAHKIKVTDMRDLEEIQTVRVESEEPKKKKKKRKQQEESTPALTKKEQKKARR
VYPQPLVSFKELRTRYKISRRLAENIAEQGFSVPTEVQLGTLPLLLEGFKVSGNSKDAES
IEPDLLVVAPTGSGKTLSFLIPVINKIVRHHHEQEEERGIFSVVVAPTKELASQIVNEGR
KLVHGTGVKITLMKKGMRVVDREDDDDENSHSEDSEEGSESEQDEPSTTRKKKGKAPVTK
SDILVTTPLLLVNALSANRTKPMATLPLVRNIVLDEADVLLDELFRDQTLDIWRACTHPE
LRASLWSATMGSNIEDLAKSTIKERKQAYDRTNSYPLLRLVVGLKDSAIPNIEHKLVYAA
TEQGKLLGLRQLLHPAAASASDVRLRPPFLIFTQTIPRAIALHSELRYDIPAEAGGSSRI
AVLHSDLSDGQRSEIMKNFRKGEIWILVTTDLLARGVDFRGINGVVNYDIPNSAAVYVHR
VGRTGRAGREGGIAVTYYTKEDIPYVKSIANIIDVSEKLRGKDGEKSIQKWLLDALPDLS
KKDKKELKKHGVKARQSNLKSVKDDKEHRKTRISTKSGFDRRMENKKKALIAASRNRKSK
TQSTDPGSDNESWDGLDG
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggacgccttcaagttgctgacaagggcaaccaagttgaagggtggcgccgccccatca
tcagcgcagagctcgacccgtctcccgtctacgggcaaggcggcgaacccgcagctcttc
cgtagctcggaggctgacaaggttctggaagaagccagacatgggaagaagaggaagaga
gtggctggtccggaggcagctgagtcggatgatgatggtgcggagttgaactttttcggc
tcgagtaaggctcggcggtctagtgcttcgatggccaaggagcaggagaaggaacagcag
gagcagcaagagcaccgggatgatacatctgatgctgatgatgctgatgagatggatgag
gtgcagtgtcgtactgtgctgaatgcgcacaaaatcaaagtcacggatatgcgtgacttg
gaggaaatccagactgtgcgtgttgaaagtgaggagccgaagaagaaaaagaagaaaagg
aagcagcaggaggagtctacgccggcacttactaaaaaggagcagaaaaaggctcgcaga
gtctatcctcagccgcttgtttcgttcaaggagttgcgcacccggtacaagatttctcgc
cggcttgccgagaacatcgccgagcagggatttagcgtgcctacggaagtccagctgggt
actctgccactgttgcttgagggtttcaaagtttccgggaattcaaaagatgctgagagc
attgaacccgacttattggttgtggctccaaccggcagtggaaagacgctgtctttcctg
attcctgtgatcaacaagatagtccgccaccaccatgaacaagaggaggagcgtggcatc
ttctctgtcgtcgttgcacctacgaaagagcttgcgagtcagatcgtgaacgagggaagg
aagctggtccatgggactggggtgaagattactctaatgaaaaagggcatgcgagtggtg
gaccgcgaggatgatgacgatgaaaacagtcacagcgaagatagcgaagaaggttcggaa
tccgaacaggacgaaccatccactacaaggaaaaagaaagggaaagcccctgttaccaag
agcgatatcctcgtcactacgccgttacttttggtcaatgcgctctcagccaaccgaacc
aaacctatggctactctacctctggttaggaatattgttcttgacgaagcagatgtcctg
ctagacgagctcttccgcgatcagaccctcgacatctggcgcgcctgcacgcaccccgag
ctccgagcaagtctgtggtcagctaccatgggatccaacattgaagatctcgccaagagc
actatcaaggagcggaaacaggcctacgatcgaaccaactcatatcccttgcttcgtctt
gtcgtagggttgaaggactctgccatccctaatatcgagcacaagctggtctatgccgca
acggagcagggaaaactcctgggtctacgacagctcctacatccagcagcggcctcggct
tctgatgtccgcctccgcccacccttcctgattttcactcagaccatccccagagctatc
gccctgcattctgaactgcggtatgatattcccgccgaggccggcggctcctcacgaatc
gcagtccttcactcagatctttcagacggtcagcgctccgagatcatgaagaacttccgc
aaaggtgaaatctggatcctcgtgacgacggatctattggcgcgcggcgtggacttccgg
ggcatcaacggagtcgtcaattacgacattccgaactcggctgcggtctacgtccaccgg
gttgggcgaacgggccgggctggccgcgagggtggcattgcagtgacttactacaccaaa
gaagatatcccgtacgtcaagagcattgccaacatcatcgatgtcagtgagaagctgcgt
ggcaaggacggagagaaatccattcagaagtggttgttggatgcactgccggacttgagc
aagaaggacaagaaggagctgaagaaacatggcgtcaaggcccgacagtccaacctcaag
agcgtcaaagacgacaaggagcaccggaagacaaggattagtaccaagagcggatttgac
cgacggatggagaacaagaagaaggccctcattgcagccagccgcaacagaaagtccaaa
acgcagtctacggaccctggtagcgacaacgagagctgggatggcctcgatggctag

DBGET integrated database retrieval system