KEGG   Aspergillus fischeri: NFIA_021560Help
Entry
NFIA_021560       CDS       T01070                                 

Definition
(RefSeq) F-actin capping protein beta subunit
  KO
K10365  capping protein (actin filament) muscle Z-line, beta
Organism
nfi  Aspergillus fischeri
Pathway
nfi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    NFIA_021560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nfi04131]
    NFIA_021560
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nfi04812]
    NFIA_021560
   04147 Exosome [BR:nfi04147]
    NFIA_021560
Membrane trafficking [BR:nfi04131]
 Protein recycling
  Others
   WASH complex
    NFIA_021560
Cytoskeleton proteins [BR:nfi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     NFIA_021560
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NFIA_021560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F_actin_cap_B F-actin_cap_A
Motif
Other DBs
NCBI-GeneID: 4591010
NCBI-ProteinID: XP_001265344
UniProt: A1D4V4
AA seq 266 aa AA seqDB search
MADIQFDSALDLLRRLNPRDTKQNLQAITSIVPDLTEDLLSSVDQPLEIRRCPKTNRDYL
LCDYNRDGDSYRSPWSNEFDPPLEDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVILLKKGVTPGAKSSGEWDSIHVFEATDRARMSHYKLTSTVILHLANENE
ALGEMDLSGNMTRQMEVDLPVESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGE
LRSLAPLSETNKEKAAHLEMIRSMQR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatccaatttgacagtgcgctcgatcttcttcggcgtctcaacccccgcgac
acgaaacagaacctacaggccattacatcgatcgtcccagacctgaccgaagacctcctc
tcctccgtcgaccagcctctagagatccgccgctgcccgaagaccaaccgcgattacctg
ctctgcgattacaaccgggacggggacagctaccgctcgccctggagcaatgagtttgat
ccgccactggaggatggcacggtccccagcgagcgggtgaggaagctcgaggttgcggct
aacgaggcctttgatgtgtatcgggagctgtactatgagggtggcgtgggcagcgtttac
ttttgggatttggatgatgggtttgcgggcgttatcctcctgaagaaaggtgttacaccc
ggagcgaagagctcaggagagtgggacagcattcatgtcttcgaggcaactgatagggcg
cgcatgtctcattacaagctcacgagcacggtaatcctgcacttggcgaatgagaatgag
gccctcggcgagatggatctcagcggcaatatgacccggcagatggaggttgatctccct
gtggagtccgatgcgagccatgtcgccaatgttggtaggctcgttgaggatatggagttg
aagatgcggaacttattgcaggaggtctactttggcaaggccaaggatgtggtgggtgaa
cttcgaagcctcgcaccgctttcggaaaccaataaagagaaggctgcacacctggagatg
attaggtccatgcagcggtag

DBGET integrated database retrieval system