KEGG   Aspergillus fischeri: NFIA_026950Help
Entry
NFIA_026950       CDS       T01070                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00010  Glycolysis / Gluconeogenesis
nfi00020  Citrate cycle (TCA cycle)
nfi00620  Pyruvate metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
Module
nfi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_026950
   00020 Citrate cycle (TCA cycle)
    NFIA_026950
   00620 Pyruvate metabolism
    NFIA_026950
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NFIA_026950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HATPase_c_5
Motif
Other DBs
NCBI-GeneID: 4587948
NCBI-ProteinID: XP_001261518
UniProt: A1DCR1
AA seq 484 aa AA seqDB search
MVASAVRMRIPSAMLSKGGLCVRRPQVIHRFKDAVQPQLPALSALSRFYASKSFPPHTII
SMPALSPTMSAGNIGAWQKKAGDSLSPGDVLVEIETDKAQMDFEFQEEGVLAKVLKETGE
KDVSVGTPIAVLVEEGTDVAPFESFTLEDAGGDKGAAPAKESKEEPKAEAAPAPSTPEPA
PAAQEPETSTEKLQPSLDREPNISPAAKALALEKGVPIKALKGTGRGGQITKEDVEKYKP
SVSAATAPTYEDIPLTSMRKTIATRLQQSMRENPHFFVSTTLSVTKLLKLRQALNASAEG
KYKLSVNDFLVKACAAALLKVPAVNSSWREENGQVVIRQHNTVDISVAVATPNGLITPVV
KNVHGLGLSSISNQIKDLGKRARENKLKPEEYQGGTFTISNMGMNPAIERFTAVINPPQA
GILAVGTTRKVAVPVETEEGTSVEWDDQIIVTGSFDHKVVDGAVGAEWIKELKKIVENPL
ELLL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggttgcctcagctgtccgaatgcgcattcccagcgccatgttgtcgaaaggcggcctc
tgcgtgaggcggcctcaggttattcacagattcaaggacgctgtccaaccccaattgcct
gcgttatccgccctctcccgtttctatgcctccaagtcctttccccctcacaccatcatc
agcatgcctgccctctcgcccacaatgtccgcaggaaacattggagcttggcagaagaag
gccggtgattccctgtcgccgggtgatgttctcgtggaaatcgagaccgataaggcacag
atggactttgaattccaagaggagggtgtcttggccaaggttctgaaggagactggtgag
aaggatgtgtctgtcggcactcctatcgccgtccttgtggaggaaggaacagatgtcgcc
ccctttgagagctttactctggaagacgccggtggtgataagggagctgctcccgccaag
gagagcaaggaggagcccaaggctgaggctgcaccagccccctcgacgcccgagcctgca
cccgccgctcaggagcctgagacatctactgagaagctccagcctagtcttgaccgtgag
cccaacatcagccctgctgccaaggcattggccctggagaaaggtgttccgatcaaggct
ctcaagggtactgggcgtggtggtcagatcaccaaggaagatgtggagaagtacaagcct
agcgtttccgccgccaccgcccctacatatgaagacatccctctcacatctatgcgcaag
accattgctacccgcctgcagcagtcgatgagagagaaccctcacttcttcgtttcgacc
actctgtccgttacgaagcttctgaagctacgccaggctctcaacgcttctgctgagggc
aaatacaagctctccgtcaacgacttccttgtcaaggcttgtgccgccgctcttctgaag
gtccctgcggtcaactcgagctggcgcgaggagaacggccaggttgtcatccgccagcac
aacaccgttgatattagtgttgctgttgccactcctaatggtcttattactcccgttgtc
aagaacgtacatggtcttggcctttccagcatctctaaccagatcaaggacctcggtaag
cgcgctcgggagaacaagctcaagcctgaggagtaccagggcggcacttttaccatcagc
aacatgggcatgaaccctgctattgagcgattcaccgctgtcatcaacccccctcaggct
ggtattttggccgtcggcaccacccgcaaggttgctgttcccgttgagactgaggagggt
acctctgttgagtgggatgaccagattatcgtgactggcagcttcgaccacaaggttgtc
gatggtgctgttggtgctgaatggatcaaggaactgaagaagattgttgagaaccccctg
gagcttcttctgtga

DBGET integrated database retrieval system