KEGG   Aspergillus fischeri: NFIA_029540Help
Entry
NFIA_029540       CDS       T01070                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit EifCc, putative
  KO
K03252  translation initiation factor 3 subunit C
Organism
nfi  Aspergillus fischeri
Pathway
nfi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    NFIA_029540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nfi03012]
    NFIA_029540
Translation factors [BR:nfi03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    NFIA_029540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI DUF1385
Motif
Other DBs
NCBI-GeneID: 4589122
NCBI-ProteinID: XP_001262419
UniProt: A1D9P1
AA seq 862 aa AA seqDB search
MSSRFFYGGGSDSDSSSSDEEELYSDREEEEKSEEEESSEEEDETSEEEESDEETGAKKF
LKDVASDSEEEEEEEKVTVVKSAKDKRLDELENTIKLIENAKKINDWAVISTEFDKLNRQ
VAKITQSGPTPKIYIKTVADLEDFVNETVAKQKSGDKKLNASQAKGFNAAKQRIKKNNKD
YANLINKYRKDKEDFMESDDEEATPVIAAPRITKLERIEAPAAAIDDDGFATVGRGGKTL
QYTPESILKHLRVIVESRGKKNTDRMEQIRTMEKLLEVAQTPYQRIRVYLTLISTRFDLT
STSSANYMAVDQWKSAEQDFSSLLSVLENNRDHVVSEGAEEWEDDEKQPTIAPGETLYIP
GSIVSFAERLDDELTRSLQHIDPHTAEYIERLSDEKLLYTDLVRAQAYVEGLNEAEKTDP
RQDSVNRVVMRRLEHVYFKPSQVITILEDATWKALPSELDSSITPRASSGNVENLVLSLC
NYLFKYSDGIIRARAMLCQIYFLALHDQYYRSRDLMLMSHLTENISNFDVSTQILFNRTL
VQIGLCAFRSGLIYEAQNTLSEVCGSGRQKELLAQGIIMQRYSTVSPEQERLERQRQLPF
HMHINLELLECIYLTSSMFLEVPLMAQTSSSPEMKRRVISKTFRRMLDYNERQVFTGPAE
NTRDGVIMSAKFLAAGDWKKAAEMLNSIKIWDLMPQPDKIKEMLSQQIQEEGLRTYLFTY
APFYDSLSIATLSNMFELSEKKISAIISRMISHEELAAALDQVNNAIVFRKGVELSRLQS
QIVTLADKSMNLLEANEKTLEQRTQGMANAFQRDQGAGARGGRGSGRGGQARGGPRFPGG
QQGRRPGGQQFGGGALGGAIKA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgcgtttcttttacggcggtggtagcgacagcgactccagctcgtctgacgag
gaggagctttacagcgatcgcgaggaggaggaaaagtccgaggaggaagagtccagcgag
gaggaagatgagacctcggaggaggaggagtccgacgaggaaacgggtgcgaagaagttc
ttgaaggatgttgcttccgacagcgaggaggaggaagaggaggagaaagtcacggttgtc
aagagtgccaaggataagagattggatgagcttgagaacaccatcaagctgattgagaac
gccaagaagatcaacgactgggctgttatctcgacagagttcgacaagctgaaccgacag
gttgcaaagatcacacaatctggtccaactcccaagatttacatcaaaaccgttgccgac
cttgaggatttcgtgaacgagactgttgccaagcagaagtccggagataagaaactgaac
gctagccaggccaagggcttcaacgctgccaagcagcgtatcaagaagaataacaaggac
tacgccaacctgatcaacaagtaccggaaggacaaggaggactttatggaaagcgacgat
gaggaggccacccccgttattgctgctccccgcatcaccaagttggagcgtatcgaggct
cccgccgctgccatcgatgatgatggcttcgcaaccgttggccgcggtggcaagactctg
cagtacacccctgagagcatcctgaagcacctccgtgtgatcgtcgagtcgcgaggaaag
aagaacacagaccgcatggagcagattcggacgatggagaagcttctggaggtggctcag
actccttatcagcgcatccgtgtttaccttactctcatttccacgcgtttcgacctcaca
tccacgtccagtgccaactacatggccgtcgatcagtggaagtccgccgagcaggacttc
tcgtccctgctgtcggttttggagaacaaccgtgaccacgttgtgtccgaaggtgccgaa
gaatgggaagatgacgagaagcaacccaccatcgcccccggcgagaccctctacatcccc
ggtagcatcgtgtctttcgccgagagactcgacgacgagcttactagatccctgcaacac
atcgacccccacaccgctgagtacattgagcgtctgagtgatgagaagctgctgtacacc
gatctcgttcgcgcccaagcctacgtcgaaggtttgaacgaagccgaaaagaccgatccc
agacaggacagtgtcaaccgggtggtcatgagacgattggagcacgtctacttcaagccc
tcgcaggtcatcacaatccttgaagatgccacatggaaggctcttccctcagagctggat
tctagcattacccctcgggctagcagtggcaacgtcgagaacctcgttttgtccctgtgc
aactatctgttcaagtacagcgatggtatcatcagagcccgcgcgatgctgtgccagatt
tacttccttgccctgcatgaccagtactaccggtctcgtgatctgatgctcatgtcccat
ctcactgagaacatttccaactttgacgtcagcactcagattctcttcaaccggacgctg
gtgcaaattggcctttgcgccttccgctccggtctcatctacgaagctcagaacaccctt
tctgaagtctgcggcagtggacgtcaaaaggagctcctggcccagggtatcattatgcag
cgctactccacggtatccccggagcaggagcgtcttgagcgtcagcgccagctgccgttc
cacatgcacatcaacctggaactgctcgagtgcatctacctcacctccagcatgttcctg
gaagttcctctgatggcccagacttcctcttctcccgagatgaagcgccgtgtcatttcc
aagaccttccgccgtatgttggattacaatgagcgccaggtcttcactggtcctgcggag
aacactcgtgacggcgtgattatgagcgccaagttccttgccgctggtgactggaagaag
gctgctgagatgctcaactcgatcaagatctgggatctgatgccccagcccgacaagatc
aaggagatgctttcccagcagatccaggaggagggcctgagaacctacctcttcacctac
gctcctttctacgacagcctctccatcgccaccctctccaacatgttcgagctttctgag
aagaagatctccgccatcatcagccgtatgatctcgcacgaagagctggcagctgctctg
gatcaggtcaacaacgccatcgtcttccgcaagggcgtcgagttgtcgcgcctccagtcc
cagatcgtcacgctggccgacaagtccatgaacctcctggaagccaacgagaagactctc
gagcagcgcacccaaggtatggccaacgccttccagcgcgatcagggcgccggcgcccgt
ggtggccgtggatccggacgcggtggtcaggcccgcggtggccccagattccccggtggc
cagcaaggccgtcggcccggtggacagcaatttggtggtggtgcattgggcggagctatc
aaggcttaa

DBGET integrated database retrieval system