KEGG   Aspergillus fischeri: NFIA_037820Help
Entry
NFIA_037820       CDS       T01070                                 

Definition
(RefSeq) AMP-binding enzyme, putative
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00061  Fatty acid biosynthesis
nfi00071  Fatty acid degradation
nfi01100  Metabolic pathways
nfi01212  Fatty acid metabolism
nfi04146  Peroxisome
Module
nfi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NFIA_037820
   00071 Fatty acid degradation
    NFIA_037820
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NFIA_037820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nfi01004]
    NFIA_037820
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfi04147]
    NFIA_037820
Enzymes [BR:nfi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     NFIA_037820
Lipid biosynthesis proteins [BR:nfi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   NFIA_037820
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   NFIA_037820
  Exosomal proteins of breast cancer cells
   NFIA_037820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding DUF5529
Motif
Other DBs
NCBI-GeneID: 4592485
NCBI-ProteinID: XP_001266105
UniProt: A1CZN8
AA seq 708 aa AA seqDB search
MFFSQQPTHLARAEELRQEPPKGTPYSVAIPGTEQPGRSRVYRAWNLQNELLKTLDPKIL
TAHDVFESTANRAPKAHCLGWRPYDPVTKTYGPYQWMDYETVRKRRAAFGAGLVELHNKH
GCGRSGPYGIGLWCQNRPEWQITDLACMSQSLYSVSIYDVLASDATEYIINHAELNCIVT
SLPHIPTLLKLKPSLPNLKIIVSLDPLDAGEPAGHSKRALLESIAAGLDVAIYTMDQVEE
LGTASNRPCVPPSPSDIVTINYTSGTTGPPKGVVLTHENAVAAASSALVNIQQAPGDTSL
SYLPLAHIYARLAEHTAFWAGARIGYFHDNIVELVDDIKALKPTAFMSVPRLYSRFGNVI
RGATVEQPGFKGALSRHIVAAKTANLKNPDPSKATVKHALYDRIWAKKVAAAIGLERCRF
MVSGSAPLDPSLHNFLRVAFGVDFIQGYGLTETYAIASSQSAKDLTAGNCGRIAPSTEAC
LMSLPDMEYSVDDKPFPRGELLLRGTNIFREYFKNPEETSKAMTEDGWFRTGDVCTIDEM
GRFIIIDRRKNVLKLAQGEYISPERLEGVYLSELSYFAQGYVHGDSVQTFLVGIFGVQPD
AFAPFASKVLGRTIDATDIEGLKSVLSDDKVRKAVLRDLEKVAKKHKLAGYERVKNCALL
IEPFSVENNLLTPTLKLKRPPTAKKYRQLLDQLYEQALEEQSAPKAKL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgtttttctcccagcaacccacccacctcgctcgtgcggaggaattgagacaagaacct
ccaaagggcactccatattcggtggctattcctggcaccgagcaacccggacggagtaga
gtctaccgtgcttggaatctccagaatgagcttttaaagaccttggaccccaagattctc
acggcgcatgatgtcttcgagtcgaccgcgaatcgagccccaaaagcccattgcctcgga
tggcgtccttacgacccggtcacaaagacctatggcccttaccagtggatggactatgag
accgttcgaaagcgaagagctgcatttggtgccggcttggtggaactgcacaacaagcat
ggatgcggacgctcgggaccatacgggattggattgtggtgtcaaaatcggccagaatgg
cagattactgatctggcatgcatgtcccagtccctctactcggtctcgatctatgatgtc
ctcgcctcggatgccaccgaatatatcatcaaccatgctgaactgaactgtattgtcact
tccttgccgcatattcccactctgctcaagctcaagccttctttgcccaatcttaagatc
atcgtgagtctggaccctctggatgctggcgaacccgccggccactcaaagcgtgcgctc
ctggaatcaatcgcggccggtctggatgtcgcaatctataccatggatcaggttgaggaa
ctgggcaccgcttcgaatcgtccgtgcgttcctccgtctccttcggacatcgtcactatc
aactatacctccggtactaccggtcctccaaagggtgtggtcttgacccacgaaaatgcc
gtggctgctgcctcttcggctctcgtcaacatccagcaggccccgggtgacacgagtttg
tcttatctcccgttggcccatatctatgcccgtttagcggagcataccgctttctgggcg
ggtgcgcgtatcggctacttccacgataacatcgtcgaactggttgacgatatcaaggcg
ttgaaacctacggcattcatgtctgtgccccgtctttacagccgctttggcaacgtcatt
cgtggtgccaccgtggagcaacccggcttcaagggtgctctgtcaagacacattgttgcc
gccaaaactgccaatctgaagaatcccgaccctagcaaagccaccgtgaagcatgctcta
tacgacagaatctgggccaagaaggtcgctgcggccattggtttggaacggtgtagattc
atggtttctggctcggcgcccctcgacccctccttgcacaacttcctgagagttgccttt
ggagtcgacttcatccagggttacggcctgactgagacgtacgccatcgcaagctcgcag
tctgcgaaggatcttaccgccggcaactgtgggcgtatcgctccttccaccgaagcctgt
ctaatgtctctgcctgacatggaatattcggtcgatgacaagcctttcccgcggggtgag
ttacttctgcgtggtaccaatatcttcagggaatacttcaagaacccggaggagacaagc
aaagcaatgaccgaggatggttggttccgcactggggatgtttgcacaattgatgaaatg
ggtcgctttattatcatcgaccgccggaagaatgtcctcaagctcgcccagggagagtac
atctctcccgaacggcttgaaggtgtctacctgtctgagcttagttactttgctcaaggc
tacgttcatggcgacagcgttcaaactttcctggttggcattttcggtgtccagcccgat
gcattcgctccatttgctagcaaagttctcggtcggactatcgacgctacagacattgag
ggactgaagtcggttctgagtgatgacaaggtccgcaaggctgtgctgagggacctcgag
aaggtcgccaagaagcacaagcttgctggttacgaaagggttaagaactgtgctttgctc
attgagcctttctcggttgaaaataacttgctgacaccgactctcaagctgaagcgtcct
cctaccgcgaagaagtatcgccagctcctggaccagctttatgagcaggctctggaggaa
caatccgctcccaaggctaagctgtaa

DBGET integrated database retrieval system