KEGG   Aspergillus fischeri: NFIA_040110Help
Entry
NFIA_040110       CDS       T01070                                 

Definition
(RefSeq) a-pheromone processing metallopeptidase Ste23
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
nfi  Aspergillus fischeri
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nfi01002]
    NFIA_040110
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     NFIA_040110
Peptidases and inhibitors [BR:nfi01002]
 Metallo peptidases
  Family M16: pitrilysin family
   NFIA_040110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 4592360
NCBI-ProteinID: XP_001266332
UniProt: A1D0B5
AA seq 1155 aa AA seqDB search
MPPRSFPSLRLWNSGGFLYFNPGHLRSFSLVPSIASTAIAPHFSSSPRRRLNCPQSLLSR
CWSRRSLSRSTVAPFSAAAVTMGSIQHITEHLEKPELDDRSYRVIRLSNKLEALLVHDPE
TDKASASVNVNVGNFSDADDMPGMAHAVEHLLFMGTKKFPKENAYNQYLASHSGSSNAYT
AATETNYFFEPSSPLYGALDRFAQFFVSPLFLESTLDRELRAVDSENKKNLQSDLWRLMQ
LNKSLSNPAHPYHHFSTGNLKTLKEDPQQRGLEVRSEFIKFYQKHYSANRMRLCVLGRES
LDELEKWVEELFSEVENKDLPQNRWDDVQPWRDEDLGIQIFAKPVMDTRSLDIYFPFLDE
ETLYESQPSRYISHLIGHEGPGSILAYIKAKGWANGLSAGVMPICPGAAAFTISIRLTKE
GLQQYREVAKVVFQYIAMLKEREPQQWVFDEMKNLAEVEFRFKQKSPASRFTSRLSSVMQ
KPLPREWLLSGSLLRKFDPDLIKKALSYLRPDNFRLIVVSQEYPGDWNSKEKWYGTEYKV
GKIPQDFMADIREALDSTPETRLSELHMPHKNEFVPTRLSVEKKEVAEPAKTPKLIRHDD
HVRLWFKKDDRFWVPKGTVHITLRNPLAWATPANLVKSKLYCELVKDALVEYSYDAELAG
LDYHLSASVFGLDVSVGGYNDKMAVLLEKVFTSMRDLVVNPNRFHIIKERLSRGYRNAEY
QQPFYQVGDYTRYLTSEKTWINEQYAAELEHIDAEDISNFFPQLLSQNHIEVLAHGNLYK
EDALKMTDLVENILQSRPLPQSQWHVRRNIIIPPGSNYVYERTLRDPANINHCIEYYVYV
GSITDDMLRAKLLLFAQMTDEPAFDQLRSKEQLGYVVWSGARYSATTIGYRVIIQSERTA
EYLESRIDNFLIQTGETLENMSEKDFEGHKRSVINKRLEKLKNLSSETSRFWSHIGSEYF
DFLQNESDAANVRALTKADIVDFYKQLLDPRSPTRGKLSIYLNAQGGAHAKVEGKDQQSR
LVSLLGKQFEGAGFAVDTSRLSSAFESADLSASDADQILAVLKKFLLSEMSLSEQQTAPV
LEQARQNIGLHAKQLGIETADKDSKPVTNGVGKPKTDRKVTYITNVPEFKARMVMSAGPI
PVTDITEFEDFDAKL
NT seq 3468 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaggtcctttccatctctccgcctgtggaactctggaggattcctctatttc
aatcctggtcatcttcgctcattctcactcgtgccttctatcgcctctacggcgattgcc
cctcatttttcctcttcgccacgtcgtcgcttgaattgccctcagtccctgctgtcacgc
tgttggtctcgtcgctccctttcccggtctactgtcgctcctttctcagctgcagccgtc
accatgggctccatccaacacattacggagcatttggaaaagccagagctcgatgatcgc
tcctatcgagttattcgcttgtcaaacaaattggaagcgctcttagtccatgatcctgaa
acggacaaggctagcgcatccgtcaatgtcaatgtgggaaatttttcagatgcagatgat
atgccaggaatggctcatgctgtagagcatttactcttcatggggacaaaaaagttcccg
aaagaaaatgcgtacaatcaatatcttgcctcacattctggctcgtcgaacgcatacaca
gcagctacggagacgaattatttttttgagccctcgtcccctctgtatggagcgctcgat
cgcttcgcacagttctttgtgtcccccctttttctggagtctactttagatcgcgagctg
cgggcggtggattcggagaacaagaagaacctccagagtgatttatggcgcttgatgcag
ttgaacaaatcattgtccaacccggcccacccttatcaccacttctcgaccggtaacctc
aagaccttgaaggaggaccctcagcaacgcggcttagaagtccgcagcgagtttattaag
ttctaccagaagcactattcagcgaaccgaatgagattatgtgtgctcggtcgagagtct
ttggatgagcttgagaaatgggtcgaagagctgttctccgaagtcgagaacaaggacttg
ccgcagaaccgatgggacgatgttcaaccctggagggacgaggatttgggcattcaaatc
ttcgctaagcccgtcatggatacccgctccttggacatctacttcccgttcctagatgag
gaaaccctctacgagtctcagccaagtcggtatatcagtcacctgattggccatgaagga
cctggcagcattttggcttatatcaaggcgaagggatgggctaacggcttgtctgccggc
gtcatgcctatctgtcccggagcagccgctttcaccatctcgattcgattgacaaaagag
ggcctgcagcagtaccgagaggtagccaaggtggtcttccagtatatcgcgatgctgaag
gaaagggagccgcagcagtgggttttcgatgagatgaagaacttggccgaggttgaattc
cgcttcaaacagaaatcccctgccagtcgattcaccagtcgactgagcagcgtcatgcag
aagccccttcccagagaatggcttctcagtggttccctcctgcgcaagttcgaccccgac
cttatcaagaaggctttgtcataccttcggcctgacaacttccggctgatcgttgtctct
caggagtatccaggagactggaactccaaggagaagtggtacggtaccgagtacaaagtg
ggcaagataccccaggacttcatggccgacatccgcgaagccttggacagcactccggag
actagactgtctgaacttcatatgccccacaagaacgagttcgtcccaactagactctcg
gtggagaagaaagaagtagcagagccagcaaagacgcccaaactcattcgtcatgacgac
catgtacgcctctggttcaagaaggacgaccgtttctgggtacccaaaggcaccgtccat
atcacgctcagaaaccccctggcgtgggccacccctgcgaacttggtaaagtcgaagctg
tattgcgaacttgtcaaggatgctttggtggaatactcgtacgatgctgaacttgctggg
cttgattatcacctttccgccagtgtctttggattagacgtgtctgttggggggtacaac
gacaagatggctgttctgctggaaaaagtgtttacgagcatgcgcgatttggttgttaat
ccgaatcgctttcatatcataaaggaacgcttgtctcggggatatcgcaatgcagagtat
caacagccgttctatcaagtcggtgattataccagatatctgacctctgagaagacatgg
atcaacgaacaatacgctgctgaattagagcatatcgacgcggaggatatctccaacttc
ttcccccaactactcagccagaatcatattgaggtccttgcgcatggcaacctgtacaag
gaggatgcccttaagatgacggacttggtggaaaacattctgcaaagccgccctctgccc
cagtcacaatggcatgtgagacgaaacattatcatccctcctggaagcaattatgtctat
gaacgcacgctccgagaccctgccaatatcaaccactgcattgagtattatgtttacgtt
ggaagtatcacggatgacatgcttcgagcaaagcttctgctgtttgcgcagatgacagat
gaaccggcctttgaccaacttcgaagcaaggagcagcttggatacgttgtttggagtggg
gcacgctattccgctacgaccattggttatcgagtcattatccagagcgagcgtacggcc
gagtatctcgagtcgcgcatcgataacttcctcattcaaacaggagagacattggaaaat
atgtcggaaaaggatttcgagggtcacaagcgaagcgtgatcaacaagagactggagaag
ctcaagaatctgagctccgagacatcgcggttctggagtcacatcggctcggaatatttc
gacttcttacagaatgaaagcgatgcggccaacgtcagggctttgactaaggctgatatc
gtggacttctataagcagcttcttgaccctcgctcaccgacccggggtaaactttcaatc
tatctgaatgctcaagggggtgcgcacgccaaagtcgaaggcaaagaccagcagtcccgg
ctagtgtcactgcttggaaagcaattcgagggcgccggctttgccgtggatacgagccgc
ctgagctctgcatttgagagcgctgatctctctgctagtgacgcagatcagattctcgcc
gttttgaagaagttcttgctctctgagatgagcttatcagagcagcagacagcaccggtg
cttgagcaagcgcgacagaacattggtctgcatgcgaagcaacttggcattgaaactgcc
gacaaggattccaagcctgtgactaatggtgttggcaagcccaagactgatagaaaggtg
acctacattaccaacgtgcctgagttcaaggcacgcatggttatgagcgctggacccatc
ccggtcacagatattaccgagtttgaggatttcgacgccaagctctga

DBGET integrated database retrieval system