KEGG   Aspergillus fischeri: NFIA_041650Help
Entry
NFIA_041650       CDS       T01070                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NFIA_041650
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NFIA_041650
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NFIA_041650
    1.1.1.-  
     NFIA_041650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_3 TrkA_N CPT_N FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 4592357
NCBI-ProteinID: XP_001266484
UniProt: A1D0R7
AA seq 364 aa AA seqDB search
MLALRLHGRQDIRLDTVPIPDCLSDQVRVRVAYCGICGSDIHEYQAGPILAPQPQETNPH
SGAKLPVILGHEISGTVVEVGADVEGIRIGQKVVVNPLLADPQIQAEACTSCLRGRFNTC
KRATYYGINAPGGGFSGEISVNAANIVPVPDNVSLRAAALAEPLAVACHMIERSGFAAGD
NILILGAGPIGLGLLILLRSKGAKKILISEVSDLRIDQAKRLGADIVINPVQESQVSDPV
LRAVHELTDEGVDIAFDASGLQATLDTAIASVRPGGTIFNVAIHEKPLSLNLNALSLQEK
HLTGGICYLRKDFEEVLSLLSSGRLPAEEMITSVVPLSNIIEGGFQELIVNKTKHVKMLI
QPDI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgctggcactccgtttacacggacggcaggatattagacttgacactgttcccattccg
gattgcctttccgaccaagtccgagtgcgcgtggcttactgcggaatctgcggctcagat
atacacgagtatcaggcagggcctatcctcgcccctcaaccccaggagacaaatcctcac
tctggcgcaaagcttccagtaatccttggacatgaaatatccggcacggttgttgaagtc
ggggcagacgtcgaggggatccgcattgggcagaaagtagtagtgaaccctttgctggca
gatccgcagattcaagctgaggcatgcacttcttgcctacgcgggcgctttaatacttgc
aaacgggccacatattacggaatcaacgcgcctggtggtggtttctccggagaaatttct
gtcaatgcagccaatatcgttcccgttcctgataacgtctcgctaagggccgctgctctc
gcagaacccttggctgtagcctgccatatgatcgaaaggtcaggttttgccgctggtgac
aatatcttgatccttggcgcgggaccaattgggttgggtctactcatacttttgcgatcg
aaaggggcgaagaagatattaataagtgaggtgtccgatctgcgaattgaccaagccaag
cgccttggagcggatattgtcataaaccctgtgcaggaaagccaggtgtctgaccccgta
ctaagggcagttcatgagttgacagacgagggggtcgacatcgcttttgacgcgtctggc
ctccaggctactcttgacaccgccatcgcgtcagtcaggccaggaggaaccattttcaac
gttgcaatccatgagaagccactaagtctcaatcttaatgctttgtctctccaagaaaaa
catttaactggcggtatttgctatttgagaaaggactttgaagaggttctgtctctcctg
tcgtctggaagacttccagcagaggagatgattacgtccgtcgtgccactttcgaacatc
attgagggaggatttcaggaactgattgtcaataaaactaagcatgttaaaatgctcatc
cagcctgacatttaa

DBGET integrated database retrieval system