KEGG   Aspergillus fischeri: NFIA_052720Help
Entry
NFIA_052720       CDS       T01070                                 

Definition
(RefSeq) cellobiohydrolase D
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_052720
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     NFIA_052720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 4584338
NCBI-ProteinID: XP_001257823
UniProt: A1DMA5
AA seq 452 aa AA seqDB search
MHQRALLFSALAVAANAQQVGTQKPETHPPLTWQKCTAAGSCSQQSGSVVIDANWRWLHS
TKDTTNCYTGNTWNTELCPDNESCAQNCAVDGADYAGTYGVTTSGSELKLSFVTGANVGS
RLYLMQDDETYQHFNLLNNEFTFDVDVSNLPCGLNGALYFVAMDADGGMSKYPSNKAGAK
YGTGYCDSQCPRDLKFINGMANVEGWKPSSNDKNAGVGGHGSCCPEMDIWEANSISTAVT
PHPCDDVSQTMCSGDACGGTYSATRYAGTCDPDGCDFNPFRMGNESFYGPGKIVDTKSEM
TVVTQFITADGTDTGALSEIKRLYVQNGKVIANSVSNVADVSGNSISSDFCTAQKKAFGD
EDIFAKHGGLSGMGKALSEMVLIMSIWDDHHSSMMWLDSTYPTDADPSKPGVARGTCEHG
AGDPEKVESQHPDASVTFSNIKFGPIGSTYKA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaacgcgcgctccttttctctgctcttgctgtagccgccaatgctcaacaggtc
ggcacacagaaaccggaaacccaccctcctctgacctggcaaaagtgtactgctgctggc
agttgcagtcagcagagcggctccgttgtgattgatgccaactggcgctggctgcattca
accaaagataccaccaactgctatactggcaacacgtggaacacggagctctgccctgac
aacgaatcctgcgctcaaaactgtgctgtagatggtgccgattacgcgggcacatacggt
gtcactacatctggatccgagcttaagctcagcttcgtcaccggtgccaatgttggctcg
cgcttgtaccttatgcaggatgacgagacgtatcagcatttcaacctgctgaacaacgag
ttcaccttcgatgttgatgtctcgaaccttccttgcggtctgaacggtgctctgtacttt
gtggctatggatgccgatggtggcatgtctaaataccctagcaacaaggccggtgcgaag
tacggaaccggatactgtgattcccagtgccctcgggatctcaagttcatcaatggcatg
gccaacgtggaaggttggaagccctccagcaacgacaagaacgcaggcgttggtggccac
ggatcctgctgccctgagatggatatctgggaggctaacagcatttccactgccgtgact
cctcatccctgtgacgatgtctcgcagaccatgtgcagcggtgatgcctgcggtggcact
tactctgctacccgctatgcaggcacttgtgatcccgatggctgtgacttcaatcctttc
cgcatgggcaacgagtccttctatggccctggaaagatcgttgatacgaaatccgagatg
accgtagtgactcagttcattactgctgacggcactgacactggtgctctttccgaaatt
aagcgtctctacgtccagaacggtaaggtgattgccaactctgtctccaacgttgccgat
gtgtctggtaactcgatttcctcggacttctgcacggcccagaagaaggcctttggcgat
gaggatattttcgcgaagcacggcggcctcagcggcatgggcaaagccctgtctgagatg
gtcctcatcatgagcatctgggacgatcaccattctagcatgatgtggctcgacagcacc
taccccactgatgctgatccctcgaagcctggcgttgcccgtggcacctgcgagcacggc
gccggcgacccggagaaggtcgagtcccagcaccctgatgcctctgtgactttctccaac
atcaagtttggtcccattggttcgacctacaaagcttaa

DBGET integrated database retrieval system