KEGG   Aspergillus fischeri: NFIA_053290Help
Entry
NFIA_053290       CDS       T01070                                 

Definition
(RefSeq) GDP-mannose pyrophosphorylase A
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00051  Fructose and mannose metabolism
nfi00520  Amino sugar and nucleotide sugar metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NFIA_053290
   00520 Amino sugar and nucleotide sugar metabolism
    NFIA_053290
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     NFIA_053290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep IspD Glycos_transf_2 DUF4954 Hexapep_2
Motif
Other DBs
NCBI-GeneID: 4584395
NCBI-ProteinID: XP_001257880
UniProt: A1DMG2
AA seq 437 aa AA seqDB search
MLHVPVREHSTLASTKAVILVGGPSRGTRFRPLSLDVPKPLFEVAGHPIINHCLKALAKI
SDIREVILVGYYDESVFRDFIKDSSKEFPQFRIQYLREYTALGTAGGLYHFRDAILKGKP
ERIFVLNADVCCSFPLGEMLKLFEEKDAEAVILGTRVSNDAATNFGCIVSDAHTKRVLHY
VEKPESHISNLINCGVYLFATECIFPAIRSAIKRRTTRPRLLSYPSSENLESSFVAADEE
TEKSEVLRLEQDILSDLADSNRFFVHETKDFWRQIKTAGSAVPANALYLQKAFQAQSGEL
TPPSATIVPPVYIHPTATVDPTAKLGPNVSIGARVVVGAGARIKDSIVLEDAEIKHDACV
MHSIIGWSSRVGAWARVEGTPIPMTSHSTSIIKHGIKVQSITILGKECAVGDEVRVQNCV
CLPYKELKRDVANEVIM
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacgttccagtgcgggaacattcaaccctggcctccaccaaggctgtgatcttg
gtcggaggtccttccagaggtactcggttcagacctttgtctcttgatgttcccaagccc
cttttcgaagttgccggtcaccccattatcaatcactgcctcaaggctcttgccaaaatc
tcggatatccgagaagtcatcctggtcggctactacgatgaatcggtcttccgtgatttc
atcaaagactccagcaaggagttcccccagttccgaattcaatacttgcgtgaatacacg
gcacttggcacagcaggaggtctctatcatttccgtgatgccatcctcaagggcaagccc
gagcgcattttcgtcctgaacgccgacgtctgctgctccttccctcttggtgagatgctg
aagctgttcgaggagaaggacgccgaggcggtgattctgggaacccgggtcagcaacgac
gccgcgaccaactttggatgtattgtctccgatgctcacaccaagcgcgtgctgcactac
gtcgaaaagccggaatcgcacatctccaacctcatcaattgcggtgtctacctctttgct
accgagtgtatctttcccgccatccgcagtgccatcaagcgccgtactacccggcctcgt
ctcctctcatacccttcctcggaaaacctggagtcctccttcgttgccgccgacgaggag
acggagaagagcgaggtcctccgcctggagcaggacatcctctccgacttggcggacagc
aaccggttcttcgtccacgagaccaaggatttctggcgacagatcaagaccgctggctcg
gccgtccccgccaatgcgctgtacctgcaaaaggccttccaggcgcaatccggcgaactc
acccctccctccgccacgatcgtgccccccgtctacatccaccccaccgcaaccgttgac
ccgaccgccaagttgggccccaacgtttccattggtgcccgtgtcgtcgtcggcgctgga
gctcgtatcaaggactctatcgtgctggaggatgcagagatcaaacacgatgcgtgcgtg
atgcactcgattatcggctggagcagccgggtgggcgcctgggctcgtgtcgagggaacc
cccatccccatgacgagccactccaccagcattatcaagcatggcatcaaggtgcagagc
atcaccatcttgggtaaggagtgtgctgtcggcgacgaggtgcgggtacagaactgtgtg
tgtctgccatacaaggaactcaagagggatgttgccaacgaggttattatgtag

DBGET integrated database retrieval system