KEGG   Aspergillus fischeri: NFIA_054670Help
Entry
NFIA_054670       CDS       T01070                                 

Definition
(RefSeq) GPI transamidase component Gpi16, putative
  KO
K05292  GPI-anchor transamidase subunit T
Organism
nfi  Aspergillus fischeri
Pathway
nfi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    NFIA_054670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 4584533
NCBI-ProteinID: XP_001258018
UniProt: A1DMV0
AA seq 600 aa AA seqDB search
MVVRSFLPLLSLLIALATFTSAASDYHEALVLQPLPQSSLLASFNFRGNTSQEAFDQRHF
RYFPRALGQILQHTHTKELHIRFTTGRWDAESWGTRPWNGTKEGNTGVELWAWIDAPDSE
SAFARWISLTQSLSGLFCASLNFIDSTRTTRPVVSFEPIGDHSPSSDLHLLHGTLPGEVV
CTENLTPFLKLLPCKGKAGVSSLLDGHKLFDASWQSMSVDVRPVCPQGGECLMQIEQTVD
IVLDIERSKRPRDNPIPRPVPNDQLNCDNSKPYHSDDTCYPLERGSGKGWSLNEIFGRTL
NGVCSLDEGQRPGEEAICLRVPHEQGVYTTSGVEETKRPDGYTRCFTLQPSGTFDLVIPE
QSHTSLAPRDEPVLSAERTIVGHGQERGGMRIIFDNPSDAHPVDFIYFETLPWFLRPYVH
TLRATITGRDGATRSVPVSHIVKETFYRPAIDRERGTQLELALSVPAASIVTLTYDFEKA
ILRYTEYPPDANRGFNVAPAVIKLSSANGNTIAHDTPIYMRTTSLLLPLPTPDFSMPYNV
IILTSTVIALAFGSIFNLLVRRFVAADQAAALTAQTLKGRLLGKIVALRDRISGKRSKVE
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggttgtccgctcctttctccccctactgtccctcctgatcgcgttggcgaccttcacc
tccgccgcatcggactaccatgaagctctcgtcctgcagccgcttcctcaatcctccctg
ctagcgtcattcaatttcaggggcaatacttcgcaagaggcttttgatcaacggcatttt
cgctacttcccccgtgctctaggccaaatcctacaacacacccacaccaaggagctacat
attcggttcacaacagggagatgggatgctgaaagctggggtacacgtccctggaacggg
acgaaggagggaaatacaggtgtagagctatgggcatggattgatgcgccggacagcgaa
agcgcatttgcccgatggatatccttgacccagtcactgtctggtttgttctgcgcatcg
ctgaattttattgattcgactcgaacgactcgaccggttgtatcattcgagcctatcggg
gatcattccccctccagtgacctgcatttgctgcatggaacgcttcctggagaagttgtc
tgcacggagaacctgacgcccttcctgaaattacttccctgcaagggcaaggctggcgtt
tctagtctactggatgggcacaagctatttgatgcttcctggcagagcatgtctgttgat
gtgcgtcccgtctgccctcaaggcggggagtgtctcatgcaaatcgagcaaacagtagac
attgtgttagacattgaacgctccaaacggcctcgagacaacccgattccacgtcctgtt
cctaatgatcagttgaactgtgacaattcgaagccttatcattcagacgatacctgttat
cctctggaaagaggctcgggcaaaggctggagcttgaacgagatctttggtcgtacttta
aatggcgtctgttcccttgacgaaggccaacgtcctggtgaagaagcaatctgtttgcgg
gtgccgcatgagcaaggggtatataccacatctggagtggaagagacgaaaaggcccgac
ggatacacccgttgttttaccttgcaaccatccggcacatttgacttggtgatcccggag
caatctcacacgagcttggcccctcgggatgaaccggttttgagtgcggaacgcacgatt
gttggccatggccaagaaagaggtggcatgcgtattatttttgacaacccatcggatgcg
catccggtcgacttcatctattttgagactcttccctggttcttgcggccctatgtccac
acattacgcgcgacgatcacagggcgcgacggagccactagatcggttcccgtctcgcac
attgtgaaagagacattttacagaccggccatcgatagagaaagaggaacacagttggaa
cttgcactctctgtgcctgctgcttccatcgtcactctcacctatgactttgagaaggca
atcctacgctacaccgagtatccaccggacgccaaccgtggcttcaacgtcgctcctgcg
gtgatcaaactgtctagcgcgaacggcaacaccattgctcacgatactccgatctacatg
cgcaccaccagcctcctcctcccgctaccgactcccgacttcagcatgccgtacaacgtg
atcatcttgaccagtaccgtgattgcgcttgcgttcggaagcatcttcaatctcctggtc
cgccgttttgtcgcagctgatcaggctgctgcgcttaccgcgcaaaccctgaaaggcagg
ctgctagggaagattgtagctctacgagatcgtatcagcggaaagagatcgaaggtagaa
tag

DBGET integrated database retrieval system