KEGG   Aspergillus fischeri: NFIA_055040
Entry
NFIA_055040       CDS       T01070                                 

Definition
(RefSeq) C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00100  Steroid biosynthesis
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Module
nfi_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    NFIA_055040
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     NFIA_055040
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 Ferlin_C
Other DBs
NCBI-GeneID: 4584567
NCBI-ProteinID: XP_001258052
UniProt: A1DMY4
AA seq 496 aa
MAPRKDFKATVPIQPVPGKRGYEFGGPLGAFVFIFGLSTLIYSLTFLCNDVSGCPVPSLL
HPSTLSLDKLKEEVGWPQEGLKAFFDIRVTMWVLSYYVLSLVLYVFLPGEVVEGTELACK
GRLRYKFNAFPSAILILSGLALGTYVHGADFVVWTFLWDNYVQIITANLMICIVLAVFVY
ARSFSIPAPGQLNPELRELAPGGHTGNALYDFFIGRELNPRVQLPIPFVDEASRTIDINV
WCEMRPGLIGWIILNLSNIARQHRTYGYITNSIVLSTVFQTFYVLDALYMEPAVLTTMDV
IMDGFGYMLSFGHLVWVPFVYNIQTRYLAVFPLKLSLKEILLILTVTGAGYAIFRGANNQ
KNRFRRDPNDPRMKHIKYIQTSSGSKLMISGWWGLARHVNYLGDWLMSWSYSLPTGIAGY
TIIESINSSGDVQKQAIQTPEVRGWGMIFTYFFLFYFGVLLIHRDGRDEEKCKRKYGADW
ERYTSIVRSRIIPGIY
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggcaccgaggaaggatttcaaggctacggttccaatacagccagttccgggaaaacgg
gggtatgagtttggtggccctctcggcgcgtttgtattcatctttggcctctcgacgctt
atctacagcctcaccttcctgtgtaacgatgtgtcaggctgtcctgttccgtcgctgctg
catccgtcgacattgtccctagacaagctaaaggaggaggttggctggccacaagaaggt
ctcaaagcgttctttgacattcgggtgaccatgtgggtgctgagttattacgtactcagt
ctggttctgtacgtatttctaccaggtgaggtggttgagggcacggaattggcctgcaag
ggaaggcttcgctacaagttcaatgcctttccttccgccattttgatcctcagtggttta
gctctgggcacatacgtgcacggtgccgacttcgtcgtatggacttttctctgggataac
tacgtgcagatcatcacggcaaacttaatgatttgcatagtcctcgctgtctttgtttat
gcgagaagtttctccatccctgcacctggtcaactcaaccccgagctgcgagaattggca
ccaggtggtcacactggaaatgctctgtatgattttttcattggccgggagcttaatcct
cgagtgcagttgcccatcccctttgttgatgaggcctcacgaacgatcgatatcaatgta
tggtgcgaaatgaggccaggtctgattgggtggatcatattgaacttgtccaacattgcc
cgccaacacaggacgtacggctacattaccaactccatcgtgctctctaccgtgttccaa
accttctatgttctggatgcgctgtatatggagccggccgtgctaaccacaatggacgtg
attatggatggattcggttacatgctctcttttggacacctggtatgggtaccgttcgtc
tacaatatccaaaccaggtaccttgcggttttccccttgaaattgagcttgaaggaaatc
cttctgatcttgactgttaccggcgcggggtacgccattttccgcggtgccaacaatcag
aagaaccgtttccgcagggacccaaacgacccacgcatgaagcatatcaagtacatccag
acgtctagtggctctaagctaatgatttctggctggtggggactggcacgccatgtcaat
tatttgggcgattggctgatgtcatggtcatattcattgcccaccgggattgctggctac
accataattgaaagcatcaatagcagtggtgacgtgcagaagcaggccatacagactccc
gaagtacgtgggtggggaatgattttcacctacttcttcttgttttattttggtgtcctg
ctcattcaccgggacggacgcgatgaagaaaagtgcaagaggaaatatggcgctgactgg
gagcgctatacgtctattgttcgcagccgcatcattcctggtatctactag

DBGET integrated database retrieval system