KEGG   Aspergillus fischeri: NFIA_059090Help
Entry
NFIA_059090       CDS       T01070                                 

Definition
(RefSeq) ubiquitin conjugating enzyme (UbcK), putative
  KO
K06688  ubiquitin-conjugating enzyme E2 C [EC:2.3.2.23]
Organism
nfi  Aspergillus fischeri
Pathway
nfi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NFIA_059090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nfi04121]
    NFIA_059090
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     NFIA_059090
Ubiquitin system [BR:nfi04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   NFIA_059090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B RWD UEV
Motif
Other DBs
NCBI-GeneID: 4584971
NCBI-ProteinID: XP_001258455
UniProt: A1DP37
AA seq 181 aa AA seqDB search
MDYVMEDTQNATPEALEASKLSSASQRNDIQSVTKRLQTELMQLMMSPSPGISAFPNADG
NLLNWTATISGPNETPYEGLTFKLSFAFPSNYPYSPPTVLFKTPIYHPNVDFSGRICLDI
LKDKWSAVYNVQSVLLSLQSLLGEPNNASPLNAQAAELWDTDKEAYKRHVVARHRDIEDL
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggactacgtgatggaggatactcagaacgccacgcccgaggctctcgaggcaagcaaa
ctgagctctgccagccagagaaatgacattcagagcgtgacaaaacgcctccaaacagag
ctgatgcagctgatgatgtccccctcgcccggcatctctgccttccccaacgcagacggc
aaccttctcaactggacggccacgatcagcggacccaacgaaacaccatacgagggactg
accttcaagctctccttcgccttccctagcaactatccttactcgcctcctacggttctc
ttcaaaacacccatctaccacccaaatgtcgacttctccggccggatctgcttggatatc
ctcaaagacaagtggagtgccgtatataacgtgcagagtgttctactgagcctgcagagc
ttgctcggggagcccaacaacgcgagtcctctaaacgcccaagcagctgagctctgggac
acagacaaggaagcatacaagcgccatgtcgtcgcacggcaccgcgatatcgaagatctt
gagtga

DBGET integrated database retrieval system