KEGG   Aspergillus fischeri: NFIA_060300Help
Entry
NFIA_060300       CDS       T01070                                 

Definition
(RefSeq) l-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00260  Glycine, serine and threonine metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NFIA_060300
Enzymes [BR:nfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NFIA_060300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase OKR_DC_1 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 4585087
NCBI-ProteinID: XP_001258571
UniProt: A1DPF3
AA seq 369 aa AA seqDB search
MSPSDMSFLQEPNLWQGHGDAEFDLRSDTITKPTLQMLEAIAKCTLSDDVFQEDKTTNSL
QEYIAQRTGHEAGLLVMSGTMGNQVAIRSHLSDPPYSVLCDHRAHILQSEAGGVSAWTGA
TVNGIMPKNGQYITLEEIQKHVVLGNNIHRCPTKLISLENTLYGMVMPLAETKRIVNWAH
AQGIKVHLDGARLWDAVVTGAGGLSEYASLFDSVSLCFSKGLGAPIGSIIVGSQEFIDKA
RWFRKSIGGGIRQAGIISAAARFAVDEVFGLDACGTSGKLKEVHTKASRVATMWTKRGGR
LLYPVQTNMVWIDIDSAGLQPSDLARIGKRKGLRLGEKRIVMHYQTSDETLCRLEEVFQE
ALKKTCSRL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctagtgatatgtctttcctccaggagcccaacctatggcagggccatggagac
gccgaattcgatctcaggagtgacacgatcacaaagcccaccctacaaatgctagaagct
attgccaaatgcactttatccgacgacgtcttccaggaggataagaccaccaactcccta
caagagtacattgcccagcggacagggcatgaagccggcctacttgtgatgtctggaacc
atgggaaaccaagttgccatccgatcgcatctctccgacccaccctattccgtgctctgt
gatcatcgagcgcacatccttcaatcagaagccggtggagtaagtgcctggactggtgct
acagtaaatggtatcatgcccaagaatggacagtacatcaccttggaagaaatacaaaaa
cacgttgtacttgggaacaacatccatcgatgccccacgaagctaattagtctggagaac
acactgtacgggatggtgatgcctctagcggaaacgaaacgcatcgtaaattgggctcat
gctcagggaataaaagtccatttggatggcgcacgactgtgggatgcggtggtaacagga
gcaggcggtctatctgagtatgccagtttgtttgacagcgtcagcctatgcttttcgaaa
ggactcggcgcccccattggtagtattatcgtgggatctcaggagttcattgacaaggct
cgttggttccgcaaatccattggaggcggtattcgacaggctggcatcatttctgccgca
gcgaggtttgctgtggatgaagtttttggattggatgcatgtgggacgagcggaaagctg
aaagaagtccatacgaaagcaagtagggttgcgactatgtggaccaaacgtggaggaagg
ttactatatcctgttcagacgaatatggtatggatcgatatagacagcgctgggcttcag
ccgtcggatcttgcgaggattggaaagcgaaaaggactgcgtttgggcgaaaagcggatc
gtgatgcattatcagacatcagatgaaaccctgtgccgattggaggaggtgttccaagag
gccttgaagaagacatgctcgagattataa

DBGET integrated database retrieval system