KEGG   Aspergillus fischeri: NFIA_068150Help
Entry
NFIA_068150       CDS       T01070                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00260  Glycine, serine and threonine metabolism
nfi00750  Vitamin B6 metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01230  Biosynthesis of amino acids
Module
nfi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NFIA_068150
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NFIA_068150
Enzymes [BR:nfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NFIA_068150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 4590189
NCBI-ProteinID: XP_001263543
UniProt: A1D7F2
AA seq 536 aa AA seqDB search
MSHTLSQKYLSTRGASYGLSFEDVVLKGLASDGGLFIPEEIPSLPAGWETEWRDLSFEDL
AYRIMSLYISPSEIPSEDLKDIIRRSYATFRHPERTPVVELDEKRNLYLLELFHGPTFAF
KDVALQFLGNLFEYFLVRKNEGKEGKDRHHLTVIGATSGDTGSAAIYGLRGKKDVSIFIL
FPTGRVSPIQQAQMTTVLDANVHNLTVEGSFDDCQDIVKALFADPDLNSTHNIAAVNSIN
WARILAQITYYFYSYFSLTKTPGFSKDTKMRFVVPSGNFGDILAGWFAKRMGIPAEKLVI
ATNENDILDRFFRSGGQYTKNTTQAEGVKETHSPAMDILVSSNFERLLWFLAFQADGAGS
ADERRKHACESVSNWLNQLKTQGGFTVPQAVLEGAKAEFESERVSNDETIDQIKSTYTSS
FPSNLGPGSAKSSKTGGYILDPHSAVGVRAALRSIERNPGVKHISLSTAHPAKFASAVDL
ALRAEDGYDFTEVLPQEFIGLEQRESRVTPIRAGAGWVGVREVVKAEVEQELQGLR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatacgctttcgcaaaaatatctcagcacgcggggtgcctcctacgggctgtcc
ttcgaagatgtcgtccttaaaggattggcgtccgatggtggcctgttcatccccgaagaa
atcccctcgcttcctgcgggatgggagacggagtggcgcgatctcagtttcgaagatctc
gcatatcgtatcatgtcgttgtacatctcgccgagtgaaatcccctcggaagacctcaaa
gatatcattagacgttcatacgctacattccggcaccctgagcggacgcctgtggttgaa
ttggacgaaaaacgcaacctctacttgctcgaattgttccatggaccaacatttgccttc
aaggatgtagcgctacagttcctcggaaacctcttcgaatatttcttggtgcgcaagaat
gagggcaaggagggcaaggacagacaccacttgactgttattggtgccaccagtggagat
actggatcggcagccatctatggtctccggggcaagaaggatgtctccatcttcatcctc
ttccccactggacgggtgtcgcctatccagcaagctcagatgacgacagtcttggacgcc
aacgtccacaacctgacagtcgagggctctttcgatgattgccaggacattgtcaaggcc
ttgtttgccgatcctgatctcaactcaacccacaacattgccgctgtcaactccatcaat
tgggctcgtatcctggcccagatcacatactacttctactcctacttctctctcaccaag
acccccggcttctccaaagacacgaagatgcgcttcgttgttccttcaggaaatttcggt
gacattctcgccggatggttcgctaagcgcatgggcattcccgctgagaagcttgtcatc
gcaaccaacgagaacgacatcctggatcgcttcttccgtagtggtggccagtacaccaag
aacaccacacaggcagaaggcgtcaaggagactcacagccccgccatggacatcctcgtc
agcagcaactttgagcgtctcctctggttccttgcgttccaggcggacggcgccggctct
gcagacgaaagacgcaagcacgcctgcgagagcgtcagcaattggctcaatcagctcaag
acacagggtggcttcaccgtaccccaggcagtccttgagggcgccaaggccgagttcgag
agcgagcgggtgagcaacgatgagaccattgaccagatcaagtccacctacacctcttcc
ttcccctccaatctcggccccggcagcgccaagagctccaagactggcggctacattctc
gaccctcactcggctgtcggtgtgcgggcagctctgcgctctatcgagcgtaatcctggt
gtcaagcacatctccctctccacagcccacccggccaagttcgccagcgccgtcgacctg
gcccttcgcgccgaagacgggtatgacttcaccgaggttcttccccaggaattcatcggg
ctcgagcagcgcgaaagcagagtcactcctatccgcgccggcgccggatgggtaggtgtc
cgggaagtggtcaaggccgaagtcgagcaggagctgcagggcttgaggtag

DBGET integrated database retrieval system