KEGG   Aspergillus fischeri: NFIA_068340Help
Entry
NFIA_068340       CDS       T01070                                 

Definition
(RefSeq) hypothetical protein
  KO
K14289  exportin-5
Organism
nfi  Aspergillus fischeri
Pathway
nfi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    NFIA_068340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nfi03016]
    NFIA_068340
   03036 Chromosome and associated proteins [BR:nfi03036]
    NFIA_068340
Transfer RNA biogenesis [BR:nfi03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    NFIA_068340
Chromosome and associated proteins [BR:nfi03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     NFIA_068340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 4590208
NCBI-ProteinID: XP_001263562
UniProt: A1D7H1
AA seq 1250 aa AA seqDB search
MAAQDELSEGGMADLVRALELIHSPSSTNELRRQALTFVESQKESKLAARNGFLLASRVE
NASLVRYFGLTLLDHVLRHTSFTSADQVAILRDFVLKLAESIRPEDPAYYRNKIPQLWAE
IAKRSWGLDWLAMDEILVQFWGASLVHKELVLSILETLSEDIFYREDTVSSLRGTDLNRA
LVEICTPLSVFEEIYPKREHHVELRCGIEGWLARTCEFLIYCVENLQASTQARDAALKAL
ATLKSILVWAIPKAIISANCVSSIARSLTCSDEQVLLVRHLDLSQQHYTSNAELFIQAAV
EALHALYSRSNFEIEDFQPLVHLMYETEYLTLLQKLYEWSIVGPDDIDDTRYTISKKLSE
MLSYLAGFLEEKGFSLETAHGMNLTFFFHLLISVIQNHSLTVSIPVLHVWCKLLASERIG
NTDLVTGLIPPLLSICTERLIRWESLPADSDNPTVVFLNEDIDTVPERHAFVGNYRRYCS
SIIETIVQKRPQDAIPHILAGVDANLDNLYNGVEPFDVKTFSKNSLSLMRADTQFAVVEA
TLKGYNKWVSAHGKMPQQDEQKRIDLESALETWALSLMQRNYEDPILKQRIIKLIVDISS
RALDKNPSFSLKVLEHILMTRLPDLVEYPAYSEAVKELHGLASHELRRLAMRYADYFSTF
YDLLEPKIKEITMANRVDDKLHMEHTSILLIIMQRANNVDPYLRETRLKSFLEPIRQAWQ
EEEFRSTSSSFEGFCDMLGLQNVGPYMQKNQAQKLEDWSAVPLDNEGKQIQETMTRKFQQ
LPLRGTKTMLAVSTEKLKKTDLAYDLACNIWHDIVPIILPVLLQLVSNAHAFHNPANWGG
LPDDMRGVVERILTDRFWQAGISTGSRDEFYAKITASRSSLEGFASSVRGKVRAVRESCY
SMLFSMSRLREHFYGFAELPGPLSQALFKDSPHLSSHQFSVLLNISRCLIDDCPVRFRAQ
FLPPMLATLFTNIDRKVTAEWDLIEQRKEGLADGDLTDEMKSESILRQLTYSAVLMVASL
LDPQRGDPDDEPAEPSAPQPPPALSDSIRHFVLSSPEVFEPVMLFCTHALRMRDTRCCSI
ITRVIRSILQDFAPPNHSPTVVTIREFISSEVLKACITSVHEPYFVDMQKDLAQLIASIW
VLYGSSSPTPRSVILSLPGMDEQRVASTEAALLRSTAARQQRALVLDLLEGLRGVSIAEQ
GKILGSREERRKARSALQERYMSNEMEGQQISKVDINDGPDLGGVADMFG
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccaagatgagctctcagaaggcggcatggctgacctcgttcgggcactggag
ctcatccacagcccttcgtcgacaaatgagctccgcaggcaagccctgacctttgtggag
tctcaaaaggaaagcaagctagctgctcgtaatgggttccttctggcttcacgggtagaa
aacgcttccttggtccgctattttggcttaacgctcttggatcatgtactgcgtcacact
tctttcacctccgcagatcaggtggctatcctcagagactttgttctcaagcttgctgag
tcaatccggccagaggatccggcctattaccgcaacaagatcccgcagttatgggcagag
attgccaagagaagctggggcctagactggttggcaatggacgagattcttgtgcagttt
tggggagccagtcttgtacacaaagaacttgtcctgtctattctggagacattgtcagaa
gacatcttctaccgcgaagacaccgtctcatccttgcgaggcacagatctcaacagagca
ttagtggagatctgcacaccactgtcagtctttgaggagatctatccaaagcgcgagcac
catgttgagcttcggtgtgggatcgagggctggctcgcaaggacatgcgagttccttatc
tactgtgttgagaacctgcaagcttccacacaggccagagacgcagcgctcaaagctctt
gcaacattgaagtccatcttagtctgggcaattcccaaggccatcatatccgcaaattgt
gtctcgagtatcgcaaggtcgcttacctgcagcgatgagcaggtgttgttggtaaggcac
ctcgacctttcccagcagcactacacgagcaatgctgaactattcatccaggctgcagtc
gaagcactgcatgctctttatagcaggtcgaatttcgaaatcgaagacttccagcctctc
gtgcacttgatgtacgaaacagagtacttgactctcctacagaaattgtacgagtggtcc
atcgttggacccgacgacatcgatgatactaggtacacgatttcgaaaaaactatccgag
atgctctcgtaccttgcggggttccttgaggagaagggcttctctcttgagaccgcacat
ggcatgaacctcactttctttttccatctcctaatcagtgtcattcagaaccacagcttg
accgtgtcgatacctgtccttcacgtatggtgcaaactacttgcctccgagaggatcggg
aacaccgatctggtaactggattgattccccctttgcttagcatatgtactgagcgactg
atccgctgggaatcactaccagcggactctgataatcctacagtagtctttctgaatgaa
gacattgatacagtgccagaacggcacgctttcgttggaaactacaggagatattgctcg
tccatcatcgagactattgtccagaaaagaccacaagatgctattccacatattctcgcg
ggcgttgatgcaaacttggacaatctctacaatggggttgagccatttgatgtgaaaacg
ttctccaagaactctctttcgttgatgcgcgccgacactcaattcgctgttgtggaagct
acactcaagggttataacaaatgggtttcagctcatggcaaaatgccccaacaggacgag
cagaaacgaatagacttggaaagcgcgcttgagacatgggctttgagtctgatgcagagg
aactacgaggaccctattttgaaacagcgcatcatcaagcttatcgttgacatctcatcc
agggctcttgacaagaatcccagcttttcacttaaagtccttgagcatattctcatgact
cgtctccctgacttggttgaatacccggcttactcggaagctgtgaaggaactacatggg
ctggccagccatgaactccgacgcctggctatgcgctatgctgactatttctctacgttc
tacgatctgcttgagccgaaaatcaaggaaatcaccatggccaaccgggtggacgacaaa
ctccacatggagcatacctcaatcctcctaattatcatgcaacgtgccaacaacgtcgat
ccatatctgcgtgaaacccggctgaagtcctttctggaacctatcaggcaagcctggcaa
gaagaagaatttcggagcacaagctcctcattcgaaggcttctgtgacatgcttgggctg
caaaatgttgggccctatatgcaaaagaaccaagcgcagaagctggaagactggtccgcg
gtcccgctggataatgaggggaagcagattcaggaaactatgacgaggaagtttcagcaa
ctacctctgaggggaactaagaccatgctcgcagtctctacggagaaattgaagaagacc
gatcttgcttatgatcttgcgtgcaatatctggcacgacatcgttcccattatcttgccg
gtattgttacagcttgtcagtaatgctcatgccttccacaatccggcgaactggggtggc
ctgcctgatgatatgcgaggggtcgtcgaacgtatcctgaccgaccggttctggcaggca
ggcatatctactggcagccgcgacgagttctatgcgaagatcactgcgtcgcggtcttcg
ctcgaagggttcgcttcctccgttcgaggtaaggttcgggctgtccgagaatcctgctac
tcaatgctgttcagcatgagcagactgagagagcatttctatgggtttgcagaacttcca
ggacctctgtcgcaagctctctttaaggactcaccacatttatcctctcaccaattctct
gttctcctcaatatttccaggtgcttgatcgatgattgccctgtccgtttccgagcacag
ttccttcctcctatgttggcaacgctcttcaccaacattgacaggaaagtcacagcggaa
tgggaccttatcgagcaacgcaaagagggacttgcggacggggatttgactgacgaaatg
aagtcagaaagtatcctccgccagttgacttattctgcggtgctcatggtagcaagtctt
ttggatccgcagagaggtgatccggacgacgagcccgctgagcctagcgcgccgcaacca
cctccagcactttccgactcgattcggcactttgttctttcttcgccggaagtattcgaa
cccgtcatgctcttctgtacacatgctcttcgcatgcgggatacgagatgctgtagcatc
atcactcgtgttattcggtcgatcttgcaggacttcgcgcctccaaatcacagcccaact
gtagtcaccatccgcgagttcatttcctcggaagttctcaaggcctgcattacatctgtg
catgagccttactttgttgacatgcagaaagacttagcccagctgatcgcgtcaatttgg
gttctctatggctcgagtagcccaacaccacgctcggtgatcctcagccttcctggaatg
gatgaacaacgggtggcaagtacggaagccgcgcttctacgatccacggcagcacggcag
caacgtgcgctcgtgctagaccttcttgaaggcctcaggggcgtgagtattgccgagcaa
ggcaagatcttgggctcccgggaagaacgccgcaaggcacgcagtgccttgcaagagaga
tacatgagcaacgagatggaaggccaacaaatcagcaaagttgacatcaatgacgggcct
gatttgggtggtgttgccgacatgtttggttag

DBGET integrated database retrieval system