KEGG   Aspergillus fischeri: NFIA_071820Help
Entry
NFIA_071820       CDS       T01070                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase, putative
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00020  Citrate cycle (TCA cycle)
nfi00310  Lysine degradation
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
Module
nfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NFIA_071820
  Amino acid metabolism
   00310 Lysine degradation
    NFIA_071820
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NFIA_071820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-GeneID: 4590554
NCBI-ProteinID: XP_001263908
UniProt: A1D8G7
AA seq 394 aa AA seqDB search
MTFFADLAAADTIVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIETDKIDVSVNAP
ESGTIKELLVNEEDTVTVGQDLIKLELGGAPGPKEETATEKPKEAADVEKRPPAESNKPQ
PSEAPKAPSPPPEQPPTAKPQAPAPKSETPSDVKPSFEGREERRVKMNRMRLRIAERLKQ
SQNTAASLTTFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLAMKDVPAVNA
SIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGIEKAIADLGKKARDNK
LTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDRPAVVNGKVEIRPMMYL
ALTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcttcgctgatctcgctgcagctgataccatagtgaaggtccctcagatggca
gaatcgatcaccgagggtacattgaagcaattctcgaagcaggtgggcgattacgttgag
cgggacgaagaaatcgctacaattgagaccgacaagatcgacgtgtcggtcaatgcgcct
gagtctgggactattaaggagctcctcgtgaacgaagaagacactgtgacggttggccag
gacttgatcaaactcgaattaggtggcgctcctgggccaaaagaggagacagctactgag
aagccaaaggaggccgcagatgtcgagaagcggcctcctgctgagtccaacaagccacag
ccgtcagaggcccccaaagctccatcgcctccgcctgaacagcctcctactgccaagcct
caggcccctgctcctaagtcagagactccttctgacgtcaaaccgagcttcgaaggtcgt
gaggaacgcagggtgaaaatgaatagaatgaggctgagaatagccgagcgcctgaagcag
tcccagaacaccgctgcctcgctcactaccttcaacgaagttgacatgtcatccctcatg
gaatttcggaaactctacaaagatgatgtactgaagaaaaccggcgtcaagcttggcttc
atgagcgctttttctcgtgcctgcgtcctagctatgaaagacgtccccgccgttaacgca
tcaatcgaaggccccaatggtggtgataccattgtttaccgcgactacgttgacatcagc
gtggccgttgctactgagaagggccttgtgacacctgtcgtccgtaacgctgaaaccatg
gacctcgtcggaattgaaaaggccatagcagaccttggcaagaaggcgcgggacaacaag
ttgacaatcgaggatatggctggtggcacgttcaccattagcaacggtggtgttttcggc
tctttgatgggcactccgatcatcaacttgccccagactgctgttcttggactccatgca
atcaaggaccggccagcagttgtgaacggtaaagtggaaattcgtccaatgatgtacctt
gccctaacctatgatcatcgactcttggatggacgggaggcagtcactttccttgtcaag
gtcaaggaatacattgaagatcctcgtcggatgttgctcggctag

DBGET integrated database retrieval system