KEGG   Aspergillus fischeri: NFIA_077970
Entry
NFIA_077970       CDS       T01070                                 

Definition
(RefSeq) calcineurin A
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
nfi  Aspergillus fischeri
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nfi01009]
    NFIA_077970
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     NFIA_077970
Protein phosphatases and associated proteins [BR:nfi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     NFIA_077970
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 4585874
NCBI-ProteinID: XP_001259754
UniProt: A1DEQ0
AA seq 538 aa
MDQALTRAVRDKKPVPEIDFTLHTMEDGTQVSTLERVIKEVQAPALSTPTDEMFWSPEDP
SKPNLQFLKQHFYREGRLTEEQALWIIHAGTQILRSEPNLLEMDAPITVCGDVHGQYYDL
MKLFEVGGDPSETRYLFLGDYVDRGYFSIECVLYLWALKIWYPNTLWLLRGNHECRHLTD
YFTFKLECKHKYSERIYEACIESFCSLPLAAVMNKQFLCIHGGLSPELHTLEDIKSIDRF
REPPTHGLMCDILWADPLEEFGQEKTGDYFVHNSVRGCSYFFSYPAACAFLEKNNLLSII
RAHEAQDAGYRMYRKTRTTGFPSVMTIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCTP
HPYWLPNFMDVFTWSLPFVGEKITDMLIAILNTCSKEELEDETPTSVSPSAPSPPLPMDV
ESSEFKRRAIKNKILAIGRLSRVFQVLREESERVTELKTAAGGRLPAGTLMLGAEGIKQA
ITNFEDARKVDLQNERLPPSHEEVIKRSEEERRAALERAQQEADNDTGLATVARRISM
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggatcaagcactgacgcgcgcggtgagggacaagaagccggtcccggagatcgacttc
acgctacacaccatggaggatggcactcaggtctccacgctggaacgagtgattaaagaa
gtgcaagcgccggctttaagtactccaacggatgaaatgttttggtctcctgaagacccc
tcgaagcccaacctccagttcctcaaacaacatttctatcgggaaggtcgtcttacagag
gagcaggcgctatggattatacatgccggaactcagattctgagatctgaacctaatctg
ctagagatggatgcgccgatcacagtctgtggcgacgttcacggtcaatactatgacttg
atgaaactcttcgaagtcggtggcgatccgtccgagacgaggtatcttttcctgggtgat
tatgtcgacagaggttatttcagcattgagtgcgttttatatctctgggccctgaagatc
tggtacccgaacaccctttggctgctccgaggcaaccatgaatgcagacatctcacggat
tacttcaccttcaagctggaatgcaagcataaatacagcgagcgtatatatgaggcctgc
attgaatcattctgctcgttgccgctggcggcggtcatgaacaaacaattcctgtgtata
catggtggtctaagtcctgaacttcacactctcgaagatatcaaatcgattgatcgtttc
agagagcccccgactcacggtttgatgtgcgacatcctctgggctgatccgcttgaagag
ttcggacaagaaaagacaggagattacttcgttcacaacagtgttcgaggctgttcttac
ttcttctcgtaccccgcggcttgcgctttccttgaaaagaacaacctgttgtcgatcatt
cgagcacatgaggcgcaggacgctggatatcgcatgtaccgaaagactcgcacgaccgga
ttcccaagtgtgatgactatcttcagtgctcccaactacttggatgtctacaacaacaag
gctgccgttctgaagtacgagaacaacgtcatgaatatccgacagttcaactgcacgcct
cacccgtactggttgccaaacttcatggacgtgtttacgtggtcgcttcctttcgtcggt
gagaagatcaccgatatgctcatcgccattctcaatacctgctccaaggaggagctcgaa
gacgagactcctacatccgtgtcgccttccgctccatctcccccgctcccaatggacgtg
gagagcagcgaattcaaaaggcgggcgatcaagaacaagattcttgccatcggacgtctc
tcgcgtgttttccaggtgttgcgggaggagtctgagagagttactgaacttaagacggct
gctggtggccgtctcccagctggtactctgatgcttggcgccgaaggaatcaaacaggcc
attacaaactttgaggatgctcgcaaggttgacttgcagaacgagcgtcttccaccttct
cacgaggaggtcatcaagagaagcgaagaggaaagacgggctgccctcgagcgtgcgcaa
caggaggcagacaatgacaccggcttggctaccgtcgcccggagaattagcatgtaa

DBGET integrated database retrieval system