KEGG   Aspergillus fischeri: NFIA_080270Help
Entry
NFIA_080270       CDS       T01070                                 

Definition
(RefSeq) O-methyltransferase, putative
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00350  Tyrosine metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    NFIA_080270
Enzymes [BR:nfi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     NFIA_080270
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NFIA_080270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 CmcI
Motif
Other DBs
NCBI-GeneID: 4586538
NCBI-ProteinID: XP_001259982
UniProt: A1DFC8
AA seq 266 aa AA seqDB search
MAEQSQRHPRPGEHESGKELKLLHFIYEQPDIDQIRGNPQRVLDLIHKFEEKYRFMNVGA
AKGKIVTDLIAELKPHTMIELGGYVGYSAILFGDAVRRAGGKRYFSLELNPEYAAIANML
IELAGLRDFVRIIVGRSDKSLHKLCTSGEVKQIELMFLDHYKPAYTTDLMLCEQLGMIVP
NVSVLAADNVLRPGNPPYLEYVRSTVEQKREAAKKGPIKSYNKEGIPQRTVQSFLGEDDK
PGFEVLGDPNLVYKSTLHQPEGLQVR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcaaagtcagcgtcaccctcgtcctggagagcacgagagcggaaaagagctc
aagctgctgcatttcatctacgaacagcccgacattgatcagatcagaggcaacccgcaa
cgggttctggatctcatccacaagttcgaagagaaatatcgtttcatgaatgtgggagcc
gccaaaggcaagatcgtcaccgatctcattgctgaactcaagccacatacaatgatcgaa
ttaggcggctacgtaggctactcagccatactgttcggcgatgccgtccgccgagctggc
ggcaagcgctatttcagtctggaactgaatccggaatatgccgccatcgccaacatgctg
atcgagctggccggtctgcgggactttgtccgcattatcgtcggtcgaagcgacaagtcg
ctgcacaagctgtgcaccagcggcgaggtcaagcagatcgagctcatgttcctcgatcac
tacaagcccgcgtacaccacagatctgatgctttgcgaacagctcggcatgattgttccc
aatgtctcggttctggccgcggataatgtcttgcggcccggtaacccaccgtatctggag
tatgtccgcagtacggtggagcagaagcgtgaggccgccaagaagggaccgatcaagagc
tataacaaagaaggcatcccgcagcggacggtccagtctttcctgggcgaggatgataag
cccggttttgaggtgctcggggacccgaatttagtgtacaaaagcacgctacatcagcct
gaggggttgcaagtgcgttga

DBGET integrated database retrieval system