KEGG   Aspergillus fischeri: NFIA_081030Help
Entry
NFIA_081030       CDS       T01070                                 

Definition
(RefSeq) maleylacetoacetate isomerase MaiA
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00350  Tyrosine metabolism
nfi01100  Metabolic pathways
Module
nfi_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NFIA_081030
Enzymes [BR:nfi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     NFIA_081030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 4586612
NCBI-ProteinID: XP_001260056
UniProt: A1DFK2
AA seq 231 aa AA seqDB search
MADSTPPKVTLYTYFRSSCSARLRIALNLKCIPYTPIAVNLLKGEQSSTDNIALNPSGTV
PTLIVEHHSKDPVTITQSLAALEYLEEITPASSHALLPPASNPEARAVVRTLVDIMSCDV
QPVTNLRILKRVAPFGVDRAAWSKDLIEDGFRAYEAIAAKSAGLFSVGDSITMADVCLLP
AVWGAERAGVKVEEFPTIYRVAQRLEEEDAVKRAHWRTQPDTPEEFRVSSS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcagactcaacaccccccaaagtcaccctatacacctatttccgctcctcctgctca
gccagactccgcatcgccctcaacctcaaatgcatcccttacaccccaatagccgtcaac
ctcctcaaaggcgagcaatcttccacagacaacatcgcgctcaatccctccggcacagtt
cccaccctgatcgtggaacaccactccaaagaccccgtgaccatcacgcaatccctcgca
gcactcgagtacctcgaagaaatcaccccagcctcatcccacgccctcctcccaccagca
tccaaccccgaggcccgcgcagtcgtccgcaccctggtagacatcatgtcctgcgatgtc
caacctgtgactaatctccggattctgaagcgggtggcgccattcggcgtggaccgggcc
gcgtggtcgaaggatctgatcgaggatggcttccgcgcgtacgaggccatcgcggcgaag
agtgcggggcttttcagcgtgggtgatagcattaccatggcggatgtgtgtctgcttcct
gcggtgtggggtgctgagagggcgggggtgaaggtggaggagtttcctacgatctatcgg
gttgcacagcggttggaggaggaagatgcggtgaagagggcgcattggaggacgcagcct
gatacgccggaggagtttcgagtgagttcgtcttga

DBGET integrated database retrieval system