KEGG   Aspergillus fischeri: NFIA_086240Help
Entry
NFIA_086240       CDS       T01070                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00062  Fatty acid elongation
nfi00071  Fatty acid degradation
nfi00280  Valine, leucine and isoleucine degradation
nfi00310  Lysine degradation
nfi00380  Tryptophan metabolism
nfi00410  beta-Alanine metabolism
nfi00640  Propanoate metabolism
nfi00650  Butanoate metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
nfi01212  Fatty acid metabolism
Module
nfi_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NFIA_086240
   00650 Butanoate metabolism
    NFIA_086240
  Lipid metabolism
   00062 Fatty acid elongation
    NFIA_086240
   00071 Fatty acid degradation
    NFIA_086240
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NFIA_086240
   00310 Lysine degradation
    NFIA_086240
   00380 Tryptophan metabolism
    NFIA_086240
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NFIA_086240
Enzymes [BR:nfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NFIA_086240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 4587124
NCBI-ProteinID: XP_001260566
UniProt: A1DH12
AA seq 294 aa AA seqDB search
MFSRQCSRLVSSRTAIPLTSYLSRVARPYSSAAPMYEYILTSTPKPGVGLITLNRPKALN
ALSSPLFKELNDALSKYEEDKDIGAVVITGSEKAFAAGADIKEMAPLTFSNAYTNNFIAP
WSHLANSVRKPVIAAVSGYALGGGCELALMCDIIYCTASATFGQPEIKLGVIPGAGGSQR
LTHAVGKSKAMELILTGKNFSGKEAEQWGVAAKAVEGGHEELLAEALKTAETIAGYSRVS
VLAAKEVVNKSQELSLREGVEYERRLFHGLFGSKDQKIGMTAFAEKKKPEWSHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcggcaatgttcccgcctggtctcgtccaggaccgctatccctcttacatcc
taccttagccgtgttgccagaccctactcatccgctgccccgatgtacgaatacatcctc
acgtcgactcctaagcctggtgttggactgatcaccctcaaccgccccaaggcactcaac
gccctctccagcccgctcttcaaggaactcaacgatgcactatctaaatacgaggaagat
aaagacatcggagccgtcgtcatcacaggcagcgaaaaggcctttgccgccggcgccgac
atcaaggaaatggccccactgaccttctcaaacgcctacaccaacaacttcatcgccccg
tggtcgcacctcgccaactccgtccgcaagcccgtcatcgccgccgtctccggctacgcc
ctcggcggcggctgcgagctcgccctcatgtgcgacatcatctactgcaccgccagcgcc
accttcgggcagcccgagatcaagctgggcgtgatccccggcgcgggcggctcgcagcgc
ctcacccacgccgtcggcaagagcaaggcgatggagctgatcctgacggggaagaacttc
agcggcaaggaggcggagcagtggggtgttgcggccaaggctgtcgagggtgggcacgag
gagctactggccgaggcgcttaagactgcggagacgattgcgggatatagtcgggtgagt
gtactggctgccaaggaagtggtgaataaaagccaggagctttcgctcagggagggcgtg
gagtatgagaggcggttgttccatggcttgtttggaagcaaggatcagaagattggaatg
actgcgtttgctgagaagaagaagcccgagtggtctcatgagtag

DBGET integrated database retrieval system