KEGG   Aspergillus fischeri: NFIA_096000
Entry
NFIA_096000       CDS       T01070                                 

Definition
(RefSeq) BNR/Asp-box repeat protein
  KO
K18651  oligoxyloglucan reducing-end-specific cellobiohydrolase [EC:3.2.1.150]
Organism
nfi  Aspergillus fischeri
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NFIA_096000
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.150  oligoxyloglucan reducing-end-specific cellobiohydrolase
     NFIA_096000
SSDB
Motif
Pfam: Sortilin-Vps10 BNR PSII_BNR BNR_2
Other DBs
NCBI-GeneID: 4588332
NCBI-ProteinID: XP_001261877
UniProt: A1DAU0
AA seq 815 aa
MKFWLQQLGLAVLCASSAAARTAEHAYEFKSVAITGGGYITGIVGHPAEKNLLYARTDIG
STYRWEQELNKWIPLTDFLGPEDENLLGTESVAMDPTDPNRLYLAQGRYLSSNNSAFFVS
NDRGATFTRYRAPFPMGANELGRNNGERLAVNPFKPNELWMGTRNAGLMKSSDRAKTWTN
VTNFPDAAANGIGITFVIFDPQHEGTIYVGACIPGGLYYTTDGGKNWESIPGQPMQWDPS
LLVYPNETQPQSAGPQPMKAVLASNGALYVTYADYPGPWGVAYGAVHVYNTTASIWTDIT
PNANNTSPKPYTPQAFPAGGYCGLSVAPDDPDTVVVVSLDRDPGPALDSMYLSRDGGKTW
KDVSQLSTPPGSGGYWGHPIAEAALSNGTTVPWLSFNWGPQWGGYGAPSPVKGLTKFGWW
MTAVLIDPSNPDHVLYGTGATIWATDTIAQADKNLAPKWYIQAQGIEETVTLAMISPREG
AHLLSGAGDINGFRHDDLDTPQPMFGLPVFSNLNTLDWAGQRPEVIVRGGPCGHQYPDGC
GQAAYSTDGGSEWTKFQTCIKGVNTSVHNPGVMTIDASGKYVVWTSAMYVVSPSVQAVTP
PANDSGPYASSDWGKTWTSPRGLTVQTPYISADRVQPKTFYAFSGGVWYVSTDGGLSYDA
FNATKLGLPAHTGAVPVVSVDRAGEIWLALGSNGVYHTTDFGKRWKRITHKGTVADLITV
GAAAPGSTKPALFIRGSPGHPKKSDYGIYRSDDNGSTWDRVDDDDHRYGGFNLIQGDPRV
YGRVYLGTGGRGLLYADIVPGQSDKEGNVPGTGGI
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgaaattctggctccaacagctagggctggcggtactctgcgcatcgagtgccgccgca
cgcactgccgaacatgcgtacgagttcaaatctgtcgcgatcacaggaggaggctacatc
actggcattgtgggccacccggccgaaaagaacctactatacgcccgtaccgacatcggc
agcacctatcgctgggaacaggagctgaacaaatggattccactcaccgatttccttggc
cccgaggacgagaacctgctcgggacggagagcgtggctatggatccgactgatccaaat
cgtctttatttagcgcaaggccggtacctgagttccaataactctgcattcttcgtgtcg
aatgaccgaggagcgacttttacgcgataccgcgcacccttcccgatgggcgcgaatgag
ttgggtcggaataatggggagagactcgcggttaacccgttcaagccgaatgagctgtgg
atggggactcgcaacgctgggttgatgaagagtagtgaccgcgcgaagacgtggacgaat
gtgacgaacttccctgatgcggcggccaacgggattggaatcacgtttgttattttcgat
ccgcagcatgaggggacgatctacgtgggcgcttgcattcctggcggattatactatacg
accgacggaggaaagaactgggagtccattccagggcagccgatgcaatgggacccgtct
ttgctggtctatcccaacgagacgcagccgcagagcgcagggccccagccgatgaaggcg
gtattggcgtctaacggagcgctgtacgtcacctatgcggattaccctgggccatgggga
gtggcctatggcgcggtgcatgtctacaacacgacagcatccatctggacggacataacg
cctaatgctaacaatacatctcccaaaccgtataccccccaggcattcccggcaggcgga
tactgcggtctgagcgtcgcaccagacgacccagataccgtcgttgtggtgtcgcttgac
cgcgacccgggcccagcgctggatagcatgtacctctcccgcgacggaggcaagacctgg
aaagacgtgtcgcagctatctaccccaccagggagcggaggatactggggccatcccatc
gccgaagcagcactttccaacggaacaacggtcccctggctgagcttcaactggggccct
cagtggggcggatacggcgccccgtcccccgtcaagggattgaccaagttcggctggtgg
atgacagccgtgctcatcgacccgagcaaccctgaccatgtcctatacggaaccggcgcg
acgatctgggcgaccgataccattgcccaggctgacaagaatttagcaccgaaatggtac
atccaggcccaagggatcgaggaaaccgtcacgctggcgatgatcagtccccgggagggc
gcgcatctcctcagcggagcgggcgacatcaacggattccggcacgatgatctcgacacc
ccgcagccgatgttcggcctccctgtgttctcgaacctgaataccctcgactgggccgga
cagcgaccggaggtgattgtccgcggtgggccatgcgggcatcagtatccggatggatgc
ggccaggcggcttattcgacggacggagggagcgagtggaccaagttccaaacatgcatc
aagggtgtgaacaccagtgtacacaacccaggcgttatgactatcgatgcctctgggaag
tacgtcgtctggacatccgctatgtacgtcgtctcgccatctgtgcaggctgtgaccccg
ccagcgaacgactccggtccgtacgcctcgagcgactggggcaagacctggacatcgcct
cgcgggctgactgtgcagacgccatacattagcgccgatcgtgtacagccgaagacattc
tacgctttctccggcggcgtttggtacgtcagcacggacggcggcctctcatatgatgct
ttcaatgcaacaaagctgggattgcctgcgcacaccggcgctgtccccgttgtgagtgtc
gacagggcaggcgagatctggctagcgctggggagcaacggagtctatcatactacggac
tttgggaagcgctggaaacgcatcacccacaagggaacagttgctgacttgatcaccgtg
ggtgcagctgctcctgggtctacgaagccggcactgtttattcgaggctcgcctggtcat
ccgaagaagagtgattatgggatctatcggtcagatgataacgggtcaacatgggaccgg
gttgatgatgacgaccatcggtatggagggttcaatctcatccagggagaccctcgggtg
tatggacgggtgtatctgggtacaggcggtcgtggtcttctctacgcagatattgtaccg
gggcaatcggacaaggaggggaatgtaccaggaacaggaggtatttga

DBGET integrated database retrieval system