KEGG   Aspergillus fischeri: NFIA_108540Help
Entry
NFIA_108540       CDS       T01070                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase (CypB), putative
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
nfi  Aspergillus fischeri
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nfi03110]
    NFIA_108540
Enzymes [BR:nfi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     NFIA_108540
Chaperones and folding catalysts [BR:nfi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    NFIA_108540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 4593849
NCBI-ProteinID: XP_001267257
UniProt: A1CXK8
AA seq 191 aa AA seqDB search
MNFKSLLLSFFLVFAVGLALVHAEETKEPRGPKITSKEESCLDCTARLSLSALATGEKGF
GYEGSTFHRVIKSFMIQGGDFTRGDGTGGKSIYGEKFADENFKLRHTRKGLLSMANAGKD
TNGSQFFITTVPTPWLDGRHVVFGEVLEGYEIVEQIENVPKGPGDKPAETVKIVKSGEIK
DESTKGSHEEL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaaaagtcttcttttgtcctttttcctggtcttcgcggttggactcgctctg
gtccacgccgaggagactaaggagccacggggcccaaagatcacaagcaaggaagaatcg
tgcttggattgtacggcaagactgtccctaagcgctctcgctaccggtgagaagggcttc
ggttacgagggctctacgttccaccgtgtcatcaagagcttcatgatccagggcggtgac
ttcacccgtggtgacggtactggtggaaagtcgatctacggcgagaaattcgcggatgag
aacttcaagcttaggcacacccgcaagggccttctgagcatggcaaacgctggcaaagat
accaacggctctcagttcttcattaccaccgttcctactccatggctcgatggtcgccat
gttgtttttggtgaggttcttgagggctacgagattgtggaacagatcgaaaatgttccc
aagggtcctggcgacaagcctgcggagaccgtcaagattgtcaagagtggagagatcaag
gacgaatccaccaaaggtagccacgaggagctgtag

DBGET integrated database retrieval system