KEGG   Aspergillus fischeri: NFIA_114460Help
Entry
NFIA_114460       CDS       T01070                                 

Definition
(RefSeq) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00564  Glycerophospholipid metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Module
nfi_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NFIA_114460
Enzymes [BR:nfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     NFIA_114460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSDC PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 4589481
NCBI-ProteinID: XP_001262810
UniProt: A1D952
AA seq 441 aa AA seqDB search
MGGKQDHNTPKLHRVGKWMPSSHAAHQEWLGGVITHVDKNTSHKLHPVLQEFKELIESNS
RVYLLISAMFAEIPRKRPYSTDPTGCAQIRDYHHLLQVLNYLLTTAPSWNDFSHRVGLVG
LPINAVLDWSMGTPSGYAAYLDPEINRMVKKILNAWGDYLKSPESASVLNDTSSGWFGST
ARSDLEEVGNVGETSHSFEDLYVCDPSAKHHGFKSWDDFFTRVFREGVRPVASPEDDTVI
ANACEAQPYKVAHNVKERDMFWIKEQPYSVRDMLNHDELTPQFVGGTVYQAFLSALSYHR
WHSPVSGKVVKAYVVEGTYYSEPLFEGVGDPSPHQIDLSGQVTAQEYNSATATRALIFIE
ADHPAIGLMCFMGIGMCEVSTCEITVKEGQHLKKGDQLGMFHFGGSTYCLLFRKGVKVEG
FPDPSRGRNVPVRSYLAKVQP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagcaagatcacaataccccaaagttgcatcgcgtcggaaaatggatgccc
tcgagccacgctgcacaccaggaatggctcggcggagtcatcacacatgttgacaagaac
acgtcccataaattgcaccccgtgctgcaagaattcaaagaactgatcgaatccaattcc
cgcgtctacctgctcatctccgccatgttcgccgagatccctcgtaaacgaccatacagt
accgatccgacaggctgcgctcagatccgcgactaccaccacctcctgcaagttttgaac
taccttctgacgactgcacctagctggaacgacttttcacatcgcgtcggtctcgttggt
ctcccgatcaacgcagtgttggactggagcatgggtacgcctagcggctacgccgcgtat
ctggatcccgaaatcaacaggatggtcaagaagattctcaatgcgtggggggactacctc
aagtctcccgagtctgcctcggtcctcaacgatacttccagcggctggttcggctccacg
gccaggtccgatctggaggaagtcggtaacgttggcgagactagccattccttcgaggac
ctgtacgtttgcgacccttcggcaaagcaccacggattcaaatcgtgggacgacttcttc
actcgtgtcttccgcgagggcgtaagacccgtcgcgtcgcctgaggatgataccgtcatc
gcaaacgcatgcgaggcgcagccctacaaggtagcccacaacgtcaaagagcgagacatg
ttctggatcaaagagcaaccctactcggtccgcgatatgctgaaccacgacgagctcacg
ccgcagtttgtcggcggaactgtctaccaagcgttcttgagcgcgctcagctatcaccgc
tggcattcgcctgtcagcggcaaggtggtgaaagcatacgtcgttgaagggacgtactac
tccgagccgttgtttgagggagtaggggatccgtcgccccatcagatcgacctgtccggc
caggtcaccgcccaggagtataacagcgccacggcaacgagagcactgatcttcatagag
gcagatcaccccgccattggcctcatgtgcttcatgggcatcggtatgtgcgaggtttcc
acatgcgagatcacagtcaaggaaggtcagcatctgaagaagggcgaccagctcggtatg
ttccactttggagggtcgacgtattgtctgctcttccggaagggcgtcaaggtggaggga
tttccggatccttcgagaggtcggaacgtgcctgtccgaagctatctggcaaaggtgcaa
ccgtaa

DBGET integrated database retrieval system