KEGG   Nostoc flagelliforme: COO91_01507Help
Entry
COO91_01507       CDS       T05266                                 

Definition
(GenBank) putA, RHH-type transcriptional regulator
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
nfl  Nostoc flagelliforme
Pathway
nfl00250  Alanine, aspartate and glutamate metabolism
nfl00330  Arginine and proline metabolism
nfl01100  Metabolic pathways
nfl01110  Biosynthesis of secondary metabolites
nfl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nfl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COO91_01507
   00330 Arginine and proline metabolism
    COO91_01507
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfl03000]
    COO91_01507
Enzymes [BR:nfl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     COO91_01507
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     COO91_01507
Transcription factors [BR:nfl03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    COO91_01507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh PutA_N LuxC ERp29 CagY_I
Motif
Other DBs
NCBI-ProteinID: AUB35617
UniProt: A0A2K8SJL5
Position
complement(1409484..1412495)
Genome map
AA seq 1003 aa AA seqDB search
MVLQVQTSTYEAKTQEIAKQLLAATQENRSFFSSLRDQMRWDDKLLAWAMSNPGLRVQLF
RFIDTLPALHSKSEIASHLQEYLGDESVELPAALKGMLNFANPDSMPGQVAATTVGTAVE
TLAHKYISGENIKQVIKTVERLRKEKMAFTIDLLGEAVITEAEAQSYLERYLELMQQLVE
ASKNWAAIPAIDEADGEAIPKVQVSVKLTAFYSQFDPLDAKGSEERVSDRIRILLRRAKE
LGAAVHFDMEQYAYKDITLSILKKLLLEEEFRQRTDVGITIQAYLRDSEQDTKDVISWLK
ERGYPLTIRLVKGAYWDQETIKAAQKHWPQPVYNDKAATDANFENITQLLLENHQYVYSA
IGSHNVRSHSRAIAIAESLNVPRRRFELQVLYGMGDKVAKALVDKGYRVRVYCPYGELLP
GMAYLIRRLLENTANSSFLRQNLENRPIEELLAPPIVKEEKNSLTPNVQTRLIASLQTPN
SHFLGAADTDYAQEEVRTKTMQAFQSVRQQLGKTYLPLINGEYVNPPEFVDSLNPSNFSE
VVGKVGLISVEQAEQAMQAAKAAFPGWRKTPAKQRADILRKAGDLMELRRAELSAWIVLE
VGKPVKEADGEVSEAIDFCRYYADEIERLDKGVNYDIPGETNHYIYHPRGIAVVISPWNF
PLAIACGMTVAALVSGNCTLLKPAETSSVIAAKFAEILVDAGFPKGVFQYVPGKGSQVGA
YLVNHPDTHVIAFTGSQEVGCRIYAEAAILKPGQKHMKRVIAEMGGKNAIIVDESADLDQ
AVVGVVQSAFGYSGQKCSAASRVIVLQPIYDAFVQRLVEATKSLNIGEAELPSTQVGPVI
DANARDRIREYIEKGKAEAEVALELQAPEQGYFIGPVIFSEVSPNAVISQEEIFGPVLAV
IRVKDFQEALAVANGTNYALTGGLYSRTPSHIQQAQTEFEVGNLYINRNITGAIVGRQPF
GGFKLSGVGSKAGGPDYLLQFLEPRAVTENIQRQGFAPIEGAD
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
gtggtattacaagtacaaacaagcacctacgaagctaaaacccaagaaattgctaaacaa
cttctagcagcaacgcaggaaaatcgttcgtttttttcttccctgcgggatcaaatgcgc
tgggatgataaattactcgcttgggctatgagtaatcctgggttgcgggtgcaactattt
cgctttatagatacgctacctgctttacacagtaaatcagaaattgcctcacatttacaa
gaatatttaggagatgagtctgtagaattgccggcagctttaaagggaatgctaaacttt
gctaaccccgactcgatgccaggacaagttgctgctacaaccgttggtacagccgttgaa
actcttgctcataaatatatttctggggaaaatattaaacaagtcatcaaaacagttgaa
cgattgagaaaagagaaaatggctttcaccatcgatttacttggtgaagcagtaattacc
gaagccgaagcgcagtcttatctagaacgctatctagaattaatgcaacaattggtggaa
gcatcgaagaattgggcagctattccggctattgatgaggctgatggtgaagcaatacca
aaagttcaggtttctgttaagttaacagcgttttattcccaattcgacccattagatgct
aaaggtagtgaagagcgagttagcgatcgcattcgtattctcttacgtcgtgctaaagaa
ttaggcgcagctgtccattttgatatggaacagtatgcctataaagacataactcttagc
atcctgaaaaaactgctcttagaagaagagtttcggcaacgcacagatgttgggataact
attcaagcatatctgcgtgatagcgagcaagatactaaagacgtaatttcctggttgaaa
gaacgtggctatcccctgacaatccgcttggtaaaaggcgcatattgggatcaggaaact
atcaaagcagcccagaagcattggccacagccagtttacaacgacaaagcggcaactgat
gctaactttgaaaacatcactcagttgttgctagaaaatcatcaatatgtctattctgcc
attggtagccataatgtgcgatcgcactctcgcgccattgccatcgctgaaagtttaaat
gtcccccgccgtcgctttgaattgcaagtcctctacggcatgggtgataaagttgcaaag
gcgttggttgacaagggttatcgagtcagagtttactgcccttacggtgaattattacct
ggaatggcgtatttaattcgtcggttgttagaaaatacagctaatagttcttttttacgg
caaaatctcgaaaatcggccaattgaagaattattagcgccgccgattgtcaaagaggaa
aagaactctttaactcctaacgtacagacgcgattaatcgcgtctctccaaactcctaac
tctcattttctcggtgctgctgataccgattacgcccaagaagaggtaagaacgaagacg
atgcaagcttttcaaagcgttcgccaacagttgggtaaaacttatttacccctaattaat
ggcgagtatgttaatccgccggaatttgttgattctctcaatccttctaatttcagcgag
gtagttggtaaagttgggttgattagcgttgaacaggcggaacaggcgatgcaagctgct
aaagctgcctttcctgggtggcgaaaaacaccagctaaacaacgcgctgatattttgcgg
aaagcgggtgatttgatggaactccgccgcgctgaactttcagcttggatagttttggaa
gttgggaaacccgttaaagaagctgatggagaggtttcggaagcgatagatttctgtcgg
tactacgctgatgagatagaacggttagataaaggtgtgaattatgacatacctggcgaa
actaatcattatatctaccatccacgcggaattgctgtggtgatttctccttggaatttt
ccgctagcgatcgcttgtggaatgactgttgcagccttggtttcaggcaattgcactctc
ctcaaacctgcggaaacatcttctgtgattgcagcgaaattcgcagaaatcttagtagat
gctggttttcctaaaggtgtctttcaatacgtacctggcaagggttcgcaagtcggcgct
tatttggtaaatcatccagacactcatgtaattgcttttactggttcccaagaagtcggc
tgtagaatttacgcagaggcggcaatcttaaaaccgggacaaaagcacatgaaacgggtg
attgctgaaatgggtggcaagaatgccattattgtggatgaaagtgctgatttagatcaa
gctgttgtgggggtagtgcagtcggcatttggttacagtggacaaaaatgttctgctgct
tccagggtaattgtgctgcaaccaatttatgatgcctttgtgcaacggttggtggaagcg
acaaaatccttgaacattggggaagcagagttaccaagtacacaagttgggccagtaatt
gatgctaatgcccgcgatcgcatccgcgagtatattgagaagggtaaggcagaagcagaa
gtggcattggagttacaagcacccgaacaaggatattttatcgggcctgtgatatttagt
gaagtatcgccaaatgcggtaatttcccaagaagaaatttttggccctgtgctggcggta
attagagtcaaagatttccaggaagcgttagcagtcgccaacggtacaaattacgctttg
actggaggactttattctagaacaccttcgcacattcagcaggcgcagacagaatttgaa
gtcgggaatttgtacatcaatcgtaatattacaggagcaatcgttgggcggcaacccttt
ggtggattcaaactttctggagtaggttctaaagcaggcggccctgattacctcctgcaa
ttcctggaaccacgcgcggtgacagaaaatattcagcgccaaggttttgcaccaattgaa
ggtgctgattaa

DBGET integrated database retrieval system