KEGG   Nostoc flagelliforme: COO91_05985Help
Entry
COO91_05985       CDS       T05266                                 

Definition
(GenBank) rbcL, ribulose-bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nfl  Nostoc flagelliforme
Pathway
nfl00630  Glyoxylate and dicarboxylate metabolism
nfl00710  Carbon fixation in photosynthetic organisms
nfl01100  Metabolic pathways
nfl01110  Biosynthesis of secondary metabolites
nfl01120  Microbial metabolism in diverse environments
nfl01130  Biosynthesis of antibiotics
nfl01200  Carbon metabolism
Module
nfl_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nfl_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nfl_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    COO91_05985
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    COO91_05985
Enzymes [BR:nfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     COO91_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AUB39989
UniProt: A0A2K8SX07
Position
complement(5553309..5554739)
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQSKSGYQAGVKDYRLTYYTPDYTPKDTDLLAAFRMTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICYVAYPLDLFEEGSVTNVLTS
IVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFVAEAINKSQAETGEIKGHY
LNVTAPTCEEMLKRAEYAKELKMPIIMHDYLTAGFTANTTLARWCRDNGILLHIHRAMHA
VIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYIEQDKS
RGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEAVVQARNEGRNLAREGNDIIREAAKWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagagcaagtctgggtatcaagccggggttaaagat
tacagactaacttattacacacccgattacacaccaaaagataccgatcttctagctgcg
ttccgcatgacacctcagcctggtgttcctcccgaagaagcaggtgcggctgtagcggct
gagtcttccacaggtacttggacaactgtgtggacagacttgctcaccgacctcgatcgc
tacaaaggtcgttgttatgacatcgaaccagttcccggtgaagacaaccagtacatctgc
tacgttgcctatcctttggacttgtttgaagaaggttctgtaaccaacgtattaacctca
attgtaggtaacgtatttggtttcaaagctctgcgggcactgcgtctagaagatattcgc
tttcctgttgcttacatcaagaccttccaagggcctcctcacggtatccaagttgagcgc
gacaagttaaacaaatacggtcgtcctttgctgggttgtaccattaagcccaaattgggt
ctttctgctaagaactacggacgcgctgtatacgagtgcttacgcggtggtttggacttc
accaaagacgacgaaaacatcaactccgcaccattccaaagatggcgcgatcgcttcttg
ttcgtagctgaagctatcaacaaatcccaagcagaaaccggtgaaattaaaggtcactac
ctaaacgttaccgctcctacctgtgaagaaatgctgaaacgggctgagtatgcaaaagaa
ctcaaaatgcccatcatcatgcatgactacctaaccgcaggtttcaccgccaacaccaca
ttggctcgttggtgccgtgataatggtattctcttgcacattcaccgtgctatgcacgct
gtaatcgaccgtcaaaagaaccacggtatccacttccgtgtattggctaaagccctacgt
ttgtctggtggtgaccacatccacaccggcaccgtagttggtaagttggaaggtgagcgc
ggcatcacaatgggcttcgttgacctgttgcgtgaaaactacattgagcaagacaagtct
cgtggtatttactttacccaagactgggcttctctacctggtgtaatggcagttgcttct
ggtggtatccacgtatggcacatgcccgcactggtagaaatctttggtgatgactccgta
ctacaattcggtggtggtactctgggacatccttggggtaacgctcctggtgcaaccgct
aaccgcgtcgccttggaagccgttgttcaagctcgtaacgaaggccgcaacttggctcgt
gaaggtaacgatatcatccgcgaagctgccaagtggtctcctgaactagctgttgcttgc
gaactgtggaaagaaatcaagttcgagtttgaagcaatggataccgtctga

DBGET integrated database retrieval system