KEGG   Candidatus Nitrosocosmicus franklandus: NFRAN_0717Help
Entry
NFRAN_0717        CDS       T05935                                 

Gene name
pckA
Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
nfn  Candidatus Nitrosocosmicus franklandus
Pathway
nfn00010  Glycolysis / Gluconeogenesis
nfn00020  Citrate cycle (TCA cycle)
nfn00620  Pyruvate metabolism
nfn01100  Metabolic pathways
nfn01110  Biosynthesis of secondary metabolites
nfn01120  Microbial metabolism in diverse environments
nfn01130  Biosynthesis of antibiotics
nfn01200  Carbon metabolism
Module
nfn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFRAN_0717 (pckA)
   00020 Citrate cycle (TCA cycle)
    NFRAN_0717 (pckA)
   00620 Pyruvate metabolism
    NFRAN_0717 (pckA)
Enzymes [BR:nfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     NFRAN_0717 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_16
Motif
Other DBs
NCBI-ProteinID: VFJ13039
UniProt: A0A484I5N8
Position
NFRAN:complement(655114..656676)
Genome map
AA seq 520 aa AA seqDB search
MDFTINEGRRNLSVPLLVEAALLNNEGQLSSTGALSVRTGKFTGRSPDDKFIVRDEITAN
TVDWGKINHPISEENFDRILSRMTTFISENKLGDSLYTFDGYVGADRSLQLPIRVITDKA
WHCLFSTQIFIKATRTELIDFKPEFTLISLNDFASIPELEGTNSDTFIIINFKKKLILMG
STSYAGEIKKSMFSVMNFLLPQKGIFPMHCSTNLGKDGRSALFFGLSGTGKTTLSADENR
RLVGDDEHGWSHSGVFNFEGGCYAKCVNLSKEKEPQIWNAIKFGSVMENVVIDSASREPD
FSDGSLTENTRVVYPLDYIPGAVIPSVCGHPSVVIFLTADAFGVLPPVSKLSKEGAMYHF
MSGYTSKLAGTERGITEPKETFSQCFGAPFMPLKASCYAELLGEKISEHNSKVYLINTGW
SGGPYGIGKRIDLKFTRLMVSAAIKGSLEDSSYETHDIFNLQYPTTCPGVPSHMLNPRNT
WHDKDQYDFSAKRLARLFINNFKKFEPISKEIVAAGPRLD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggatttcacaattaatgaggggagaagaaacttgtctgttcccctattagttgaagct
gcgcttttaaataatgaggggcaattgtctagtactggagctttgtctgttcgaacgggc
aaattcaccggtagatcacctgatgataaattcattgtcagagatgagataactgctaat
actgtagattggggtaagattaatcatccaatttccgaagaaaattttgatcgtatactt
tctaggatgacaacttttatctctgaaaataaactaggggactccctatacacatttgac
ggatatgtaggtgcagatagatccttgcaattgccaataagagtgattacagataaagct
tggcattgcctattttctacccagatattcataaaagcaactcgtactgaattgattgat
tttaaacctgagtttaccctcatatccttaaatgactttgcctcgattcctgaattagaa
gggactaattctgatactttcatcattatcaattttaaaaagaaattgatattgatgggt
tcaacttcttatgctggcgaaatcaaaaaatcaatgttttctgtcatgaactttttatta
cctcagaagggaatattcccaatgcactgttctacaaatttaggtaaagatggaagatct
gctttgttttttggtttatcaggaactggaaaaaccaccttatctgcagatgaaaaccgt
cgattagtaggagatgatgagcatggttggtcccattctggagtttttaactttgaaggt
ggttgctatgctaaatgtgtcaatttaagtaaggaaaaagaaccacaaatatggaatgca
ataaagttcggttcggttatggagaatgtagttattgactcagcatctagggaacctgat
ttttcggacggtagtctgactgaaaatacacgtgttgtctatccattggattacattccc
ggagctgttatcccaagtgtttgtggacatccatctgtcgttatctttcttactgccgat
gcctttggagtacttcctccagtatcaaagttgtctaaggagggagcaatgtatcatttt
atgtctggttataccagcaagttagcaggaacagaaagaggcattaccgaacctaaggaa
actttttctcaatgttttggtgctccatttatgccgttgaaggcttcatgttatgctgag
ttgttaggtgaaaagatcagtgagcataattctaaagtttacctaataaacactggatgg
tcgggcggtccttatggaataggcaaaaggatcgatctcaagttcactcgattaatggtt
tcagcagcaataaagggtagtttggaagacagttcatacgagacacatgatatttttaac
ttgcagtatcctacgacatgcccgggagttccttctcatatgttgaaccccagaaatact
tggcatgataaagaccaatatgatttctctgcaaaaaggcttgcaagattgtttatcaac
aatttcaaaaaatttgaaccaatatcaaaagaaatagttgctgcaggtccacgtttggat
tag

DBGET integrated database retrieval system