KEGG   Candidatus Nitrosocosmicus franklandus: NFRAN_1938Help
Entry
NFRAN_1938        CDS       T05935                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
nfn  Candidatus Nitrosocosmicus franklandus
Pathway
nfn00310  Lysine degradation
nfn01100  Metabolic pathways
nfn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nfn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    NFRAN_1938 (lhgO)
Enzymes [BR:nfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     NFRAN_1938 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo
Motif
Other DBs
NCBI-ProteinID: VFJ14260
UniProt: A0A484I964
Position
NFRAN:complement(1709775..1710923)
Genome map
AA seq 382 aa AA seqDB search
MKDYCRSNGLAFIEDGVVEVAADPKSEKTLHQYFEWGIKNGLNESEITILSKREVSTIEP
HVRCQAAVFCKKDASVNYGQITQTMGNQIPIKNKRARIITFSKVVDIRIEPSKQSIKVEY
FDSLEKTKREIDCSFLINAAGSNSINILNKLRIEHPYQDLLFRGEYWIAPSRYNDLTRHS
IYSVPQFQQFPFLDPHWIIRVSGTREVGPNACPVLSPYGYNNFTNAKEFLPKIYGLISKK
NHGINRTLFRKELLDLVTKEALSSISKRYMINRVKKFLPSIDPKEFRTRGTAGIRSVLID
KDGSFVSNPVFILRDNILHILNYNSPGATGAIPISYAIIFKLLSEGILKCSQETITAQKV
APFDVNLVNVCKEELDIDIAWQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagactactgtcgttctaacggattagcgtttattgaggatggagtagttgaagtt
gcagctgatccgaaatccgaaaagacactccaccaatactttgaatggggcataaaaaat
ggcctgaacgaatctgaaattacgattctaagcaaaagggaagtatcaacaattgagccc
catgtaaggtgtcaagctgcagtattctgcaagaaagatgcatcagtaaattatggtcag
atcacgcaaacaatggggaaccaaatacccatcaagaacaaacgagcgagaatcataaca
ttttctaaggttgttgatattcgaatagaaccctcaaaacaatctataaaagtagaatac
tttgattctttggaaaaaacgaaaagggaaattgactgtagttttttaataaatgctgcc
ggcagcaattcgatcaatattttgaataaattgagaatagagcatccatatcaagatctt
ttgtttaggggcgaatactggattgccccatcaagatacaacgacctaacgaggcatagt
atctattcggtacctcaatttcaacaatttccttttctagatccacactggataatcagg
gtcagtggaacaagggaggtaggtccaaatgcatgtccagtattatcaccatatggatac
aataattttacaaatgcaaaagaatttcttcctaaaatatatggattaatatccaaaaag
aatcatggaataaatagaacgctttttagaaaggaattactcgatctagttaccaaagaa
gcattgagcagtatttccaaaaggtacatgatcaacagagtgaaaaaatttcttccctct
atagacccaaaggagtttaggacccgtggaacagctggtataagatcggttctaatagac
aaagatggtagttttgtatcaaacccggtttttatcctacgagacaatattttgcacata
cttaattataattctccaggggccacaggtgccatccctattagttatgccatcatattc
aagcttttaagtgaaggaatactaaagtgctctcaggaaaccataactgctcagaaggtt
gctccgtttgatgtgaatctagtaaacgtatgcaaagaggaactcgatatcgatatcgca
tggcaataa

DBGET integrated database retrieval system