KEGG   Candidatus Nitrosocosmicus franklandus: NFRAN_2574Help
Entry
NFRAN_2574        CDS       T05935                                 

Definition
(GenBank) Glucose 1-dehydrogenase 2 (fragment)
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
nfn  Candidatus Nitrosocosmicus franklandus
Pathway
nfn00030  Pentose phosphate pathway
nfn01100  Metabolic pathways
nfn01120  Microbial metabolism in diverse environments
nfn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NFRAN_2574
Enzymes [BR:nfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     NFRAN_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: VFJ14896
UniProt: A0A484IDK9
Position
NFRAN:2249067..2249384
Genome map
AA seq 105 aa AA seqDB search
MMTKTMALELAADNIRVNIVAPGAIDTDMNISLRNDLQERENTLRRIPMGRIGSDQEVAN
VVEFLASNKASYITGSTIVVDGGMTLYPSFGLHSADKNSNSIFPK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaaaacaatggccttagaacttgctgcagataatattagggtaaacatagtt
gcaccaggagcgatagatacagatatgaatatcagtcttcgaaatgatttacaggaacgt
gaaaacaccttgagaagaataccaatgggcagaataggaagtgaccaagaggtcgcaaat
gtagtagaatttctagcatccaacaaagcgagctacattacaggaagcactattgtagta
gatggaggaatgactctatatccatcatttgggttacattcggctgacaaaaactctaac
agcatttttccaaaatag

DBGET integrated database retrieval system