KEGG   Candidatus Nitrosocosmicus franklandus: NFRAN_3031Help
Entry
NFRAN_3031        CDS       T05935                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase 2
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
nfn  Candidatus Nitrosocosmicus franklandus
Pathway
nfn00860  Porphyrin and chlorophyll metabolism
nfn01100  Metabolic pathways
nfn01110  Biosynthesis of secondary metabolites
nfn01120  Microbial metabolism in diverse environments
Module
nfn_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nfn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NFRAN_3031 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nfn01007]
    NFRAN_3031 (hemL)
Enzymes [BR:nfn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     NFRAN_3031 (hemL)
Amino acid related enzymes [BR:nfn01007]
 Aminotransferase (transaminase)
  Class III
   NFRAN_3031 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 RHH_3
Motif
Other DBs
NCBI-ProteinID: VFJ15354
UniProt: A0A484IC64
Position
NFRAN:complement(2690806..2692179)
Genome map
AA seq 457 aa AA seqDB search
MKYDSYLELYKTKTFESMNLYFKSREIFPGGVSHNIRYFRPYPFFTRKARGKYLYDVDGN
KYLDFWNGHWALILGHSPPRVTQKLVKQLKNGTLYGTVNKDSLKLGWEIKKAIPLAENIR
FCSTGSEATMYATRLARSATGKRVIAKVEGGWHGFNTNLLQSVNYPYEVDEGLGLIEDEG
HFVESLQFNDIERSLKVLESIKDDLAAIIVEPVLGGAGCILPKNGYLQGLQEFAKNNGSL
FILDEIVTGFRFSYGAAMNNFNLEPDLFTLGKIIGGGLPIGAVCGKKEIMKLADATIEGD
KSTYCSIGGGTFSANPMTMKAGFHTLRTLRNDRSIYDKINNLGEFTRIELSKLFDELKIR
AEVTGIGSIFMIHFLNDNVKAINNALDAALSDKEMLNNYNLALMAYHGIFFLPGKMGAFS
NAHEKKDSIKLLNATRDIFENSKYINFLEKNDKNLVF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgacagttatctagaattatacaagactaaaacatttgaatctatgaattta
tattttaaatcaagagagatatttcctggtggagttagtcacaatatacgatattttaga
ccttatccattctttactcgaaaagcaagaggaaaatatttgtatgatgtagatgggaat
aaatacttagacttttggaacggtcactgggccctaatactggggcattccccaccaagg
gttacacaaaaattagttaagcaactaaagaatggaactctatacggtactgtaaataaa
gatagcttgaagctgggctgggaaatcaaaaaagcaataccattagctgaaaacataaga
ttttgtagtacaggttctgaagccacaatgtatgctacaaggcttgctagatcagccaca
ggtaaaagagttattgcaaaggtggaaggcggatggcatggttttaatacaaatctcttg
caatcagtaaactacccgtacgaagtcgacgaaggcttgggtctaattgaagacgaggga
cactttgtagaatctcttcaatttaatgacatagagagatcacttaaggttcttgaatca
ataaaagatgatctagcagctattatagttgaacctgttcttggtggagcaggttgtatt
ttacctaagaatggatatttgcaggggttacaagagtttgccaagaataacggtagcctt
tttattttggatgaaatagtaacaggtttcagattttcatacggggccgccatgaataat
tttaatctggaaccagatttgtttactttgggtaagataattggaggaggtctaccaata
ggtgcagtatgcggtaaaaaagagatcatgaaattagctgatgccactattgaaggggac
aagtcaacctactgttcaataggaggcggaacattttcagctaatcctatgactatgaag
gcgggtttccatactctcagaactttgaggaatgacagatctatttatgacaaaataaat
aatttgggagaattcactaggatagaattatctaaattatttgacgagttgaagataaga
gcagaagtaacgggaataggatcaatatttatgatccatttcttaaatgataatgttaaa
gccataaacaatgctttggatgccgccctatcagataaggaaatgttaaataattataat
ttagcactgatggcatatcatggtattttctttttgcctggcaaaatgggagcgttttcg
aatgcacatgagaagaaagattctattaaattattaaatgcaactagagatatctttgaa
aattccaaatatattaactttttagagaaaaatgacaagaacctggtattctag

DBGET integrated database retrieval system