KEGG   Nocardia farcinica NCTC11134: ERS450000_00990Help
Entry
ERS450000_00990   CDS       T04524                                 

Gene name
gutB_1
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ERS450000_00990 (gutB_1)
Enzymes [BR:nfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ERS450000_00990 (gutB_1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ERS450000_00990 (gutB_1)
    1.1.1.-  
     ERS450000_00990 (gutB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: CRY74829
UniProt: A0A0H5NHU6
Position
1:complement(987561..988616)
Genome map
AA seq 351 aa AA seqDB search
MRAAVYYGPNKVDVVDVPEPEPGPGEVKLRVGFNGICGTDLHEYYAGPIFVPTEPHPLTH
RQLPLVLGHEFSGTVTEVGSGVTGIEPGDRVAVEPLYTCGHCGPCRAGTYNICRRIGFHG
LMSDGGMAEYTVVPAHMIHRLPDSVPLELGALVEPMSVAYHAATLGDPKPEDTAMVFGAG
PIGIGLWFALRAKGLDDIYVVEPSPTRRAAIEALGATTLDPTAIDVPAFIDNATDGAGAD
ATYDAAGVQPAVETALACLGARRPLISVAIYEKPLTTPLQRLVMNESRIQGSLCYTSADY
RAVIDLMAQGRYDATGWVETIALEQVIDEGFEALHAGTKMKVLVDPAEVAA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagctgtgtactacggcccgaacaaggtcgacgtcgtcgacgtaccggaaccc
gagccggggcccggcgaggtgaaactacgggtgggcttcaacggcatctgcggcaccgac
ctgcacgagtactacgccgggccgatcttcgtgcccaccgaaccgcatccgctcacccac
cggcagctgccgctcgtgctcggacacgagttctccggcacggtcaccgaggtcggcagc
ggtgtcaccggcatcgagcccggcgaccgggtcgccgtcgaaccgctctacacctgcggc
cactgcggcccctgccgggcgggcacctacaacatctgccgccggatcggtttccacggc
ctgatgtccgacggcggcatggccgaatacaccgtggtcccggcccacatgatccatcgg
ctgccggactcggtgccgctcgagctcggcgcgctcgtggagccgatgtcggtggcctac
cacgccgccacgctcggtgatcccaagccggaggacaccgccatggtcttcggcgccgga
ccgatcggcatcgggctctggttcgcgttgcgcgccaagggtctcgacgacatctacgtc
gtggaaccgtcgcccacccgacgcgccgcgatcgaagcgctcggcgccaccaccctcgac
ccgaccgcgatcgacgtccccgcgttcatcgacaacgccaccgacggcgcgggcgccgac
gcgacctacgacgccgcgggcgtgcaacccgcggtcgagaccgccctggcgtgcctgggc
gcgcgccggccgctgatcagcgtcgccatctacgagaagccgctgaccacaccgctgcaa
cggctcgtcatgaacgaatcccgcatccagggctcgctgtgctacacctccgccgactac
cgcgcggtcatcgacctcatggcgcagggccgctacgacgccaccggctgggtggagacg
atcgccctcgagcaggtcatcgacgagggcttcgaggcgctgcacgcgggcaccaagatg
aaggtgctcgtcgatccggcggaggtggcggcatga

DBGET integrated database retrieval system