KEGG   Nocardia farcinica NCTC11134: ERS450000_01028Help
Entry
ERS450000_01028   CDS       T04524                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00051  Fructose and mannose metabolism
nfr01100  Metabolic pathways
nfr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ERS450000_01028 (fucA)
Enzymes [BR:nfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ERS450000_01028 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CRY74867
UniProt: A0A0H5NI89
Position
1:complement(1023888..1024673)
Genome map
AA seq 261 aa AA seqDB search
MAETMNDSKTVLMERAKQDMATQFGASEWTTRQKLALTCRALYDAGHDSGLAGQITARAE
QPGTYYTQRLGLGFDEITDANLLLVDEDLQVLEGSGMANPANRFHSWIYRARPDVRCIVH
THPFHVAALSMLEVPLVVSQMDIAPLYDDCAFLPDWPGVPVGNEEGEIITAALGDKKAVL
LAHHGHVVAGASIEEACSLAVLIERAAALQLAAMAAGTIAPLPDRLAREAHDWTLTPRRS
QANFAYYARRALVRHPDAISG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgagacgatgaacgactccaagaccgtgctcatggaacgggcgaaacaggacatg
gcgacgcagttcggcgcgtcggaatggacgacccggcagaagctggcgctgacctgccgc
gcgctctacgacgcggggcacgattccggcctcgccgggcagatcaccgcgcgtgccgag
cagccgggcacctactacacccagcggctcggtctcggattcgacgagatcaccgacgcg
aatttgctgctggtcgacgaggatctccaggtactggagggcagcgggatggccaacccg
gccaaccgtttccacagctggatctaccgtgcccggcccgatgtccggtgcatcgtgcac
acccacccgttccacgtggcggcgttgtccatgctcgaggtccccctcgtggtctcgcag
atggacatcgccccgctctacgacgactgcgcgttcctacccgactggcccggcgttccg
gtcggcaacgaggagggcgagatcatcaccgccgcgctcggcgacaagaaggccgtgctg
ctcgcccaccacggccacgtggtcgccggggccagtatcgaggaggcgtgctcactggcc
gtgctgatcgaacgggcggccgcgctgcaactggccgcgatggccgccgggacgatcgcg
ccgctgcccgaccggctcgcccgcgaagcccacgactggactctcacgccccggcgcagc
caagccaacttcgcctactacgcgcgccgcgcgctggtccggcaccccgacgcgatcagc
ggctga

DBGET integrated database retrieval system