KEGG   Nocardia farcinica NCTC11134: ERS450000_04420Help
Entry
ERS450000_04420   CDS       T04524                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00071  Fatty acid degradation
nfr00072  Synthesis and degradation of ketone bodies
nfr00280  Valine, leucine and isoleucine degradation
nfr00310  Lysine degradation
nfr00362  Benzoate degradation
nfr00380  Tryptophan metabolism
nfr00620  Pyruvate metabolism
nfr00630  Glyoxylate and dicarboxylate metabolism
nfr00640  Propanoate metabolism
nfr00650  Butanoate metabolism
nfr00900  Terpenoid backbone biosynthesis
nfr01100  Metabolic pathways
nfr01110  Biosynthesis of secondary metabolites
nfr01120  Microbial metabolism in diverse environments
nfr01130  Biosynthesis of antibiotics
nfr01200  Carbon metabolism
nfr01212  Fatty acid metabolism
nfr02020  Two-component system
Module
nfr_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERS450000_04420
   00630 Glyoxylate and dicarboxylate metabolism
    ERS450000_04420
   00640 Propanoate metabolism
    ERS450000_04420
   00650 Butanoate metabolism
    ERS450000_04420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ERS450000_04420
   00072 Synthesis and degradation of ketone bodies
    ERS450000_04420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERS450000_04420
   00310 Lysine degradation
    ERS450000_04420
   00380 Tryptophan metabolism
    ERS450000_04420
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERS450000_04420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ERS450000_04420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ERS450000_04420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfr04147]
    ERS450000_04420
Enzymes [BR:nfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ERS450000_04420
Exosome [BR:nfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERS450000_04420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N
Motif
Other DBs
NCBI-ProteinID: CRY81447
UniProt: A0A0H5P1B4
Position
p2:969029..970558
Genome map
AA seq 509 aa AA seqDB search
MLPAGMDPRTPVLVGVGQVVHRSGEPGLPGPVELAAEALRRAGADSGAGDRLVRAADVVA
AVASVSKPYPDLAAMVAGELGATPKRTAQTARFGGDGPQRLVNWAAQAIADGRAEVVLIA
GAESVAAANAAKRAGTVPDWPDQPADAAPDDVLGSDKGPNSEMETGAGLWGPIYFYALME
NALRGRLGLSEPAYLERIGGLWSRFSEIAATNPYAWLPERHSVRGLITATPDNRMVTSPY
RKLLVANLSVDQGAGLILCSAAAADAAGVPRERWVFPHGGATGNEVWFVSERADMAASPA
IAAVGAQALSDAGVGIDDIAHIDLYSCFPIAVQVGAEALGLPLDDPSRPLSLTGGLTFGG
GPGNNYTTHAIAALAERLRAEPDSFGLATALGWYATKHGVGVYSTRPPARLFRAVEVPTP
DAHRATAPGYTGPATVESYTVPYRKGPAPERADEPEAVVVSALNPAGARTLVRVSDPGII
AAFTETDPLGAKIDIVAADRITLSERTAR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgccagccggaatggacccgcggacgccggtgctcgtcggcgtcggtcaggtcgtg
caccgaagcggtgaaccgggcctgcccggcccggtggaactggccgccgaagcgctgcgc
cgcgcgggcgccgacagcggcgcgggcgatcggctggtgcgcgcggccgacgtggtcgcc
gccgtcgcgtcggtgagcaagccctacccggacctggcggcgatggtcgccggcgaactc
ggcgcgacgccgaaacgcacggcgcagaccgcgcgtttcggcggcgacggcccacagcgg
ctggtcaactgggccgcgcaggcgatcgccgacggccgcgccgaggtcgtgctgatcgcg
ggcgcggaatcggtagccgccgcgaacgccgcgaaacgcgccgggaccgtgccggactgg
ccggaccagcccgccgacgccgcgccggacgacgtgctcggctcggacaagggcccgaac
tccgagatggaaaccggggcgggactgtgggggccgatctacttttacgccctgatggag
aacgccctgcgtggacgcctcggcctgagcgagcccgcctacctcgagcgcatcggcggg
ctgtggtcacgattctccgagatcgccgccaccaacccctacgcctggctgcccgaacgg
cacagcgtgcgcggcctgatcacggccaccccggacaaccgcatggtgaccagcccctat
cgaaagctgttggtcgccaatctgtccgtcgaccagggcgccgggctgatcctgtgcagt
gcggcggccgccgatgccgcgggcgtgccgcgtgagcgctgggtcttcccgcacggtggc
gcgaccggcaacgaggtgtggttcgtcagcgagcgcgcggacatggccgcctcgcccgcc
atcgccgcggtcggcgcgcaggcgttgtccgacgcgggcgtcggcatcgacgacattgcc
cacatcgacctgtactcctgcttcccgatcgccgtgcaggtgggcgccgaagccctcggc
ctgccgctcgacgacccgagccgcccgctctcgctcaccggcgggctcaccttcgggggc
ggcccgggcaacaactacaccacccacgccatcgccgccctcgccgaacgccttcgcgcc
gaaccggattcgttcgggctcgcgaccgcgctcggctggtacgccaccaaacacggcgtc
ggcgtgtattccacccgcccgcccgcgcggctgttccgcgccgtcgaggtgcccaccccc
gacgcccaccgcgcgaccgcgcccggctacaccggccccgccaccgtcgagtcctacacc
gtcccctaccgcaagggtccggcccccgaacgcgccgacgagcccgaggccgtggtggtc
agcgcgctgaacccggccggggctcgcaccctggtgcgggtgagcgaccccggaatcatc
gccgcgttcaccgaaaccgacccgctcggcgcgaagatcgatatcgtcgccgcggaccgg
atcaccctgtcggaaaggactgcccgatga

DBGET integrated database retrieval system