KEGG   Nocardia farcinica NCTC11134: ERS450000_05024Help
Entry
ERS450000_05024   CDS       T04524                                 

Gene name
egtC
Definition
(GenBank) Amidohydrolase EgtC
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00340  Histidine metabolism
nfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ERS450000_05024 (egtC)
Enzymes [BR:nfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     ERS450000_05024 (egtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: CRY82545
UniProt: A0A0H5P3Z4
Position
p2:1656658..1657500
Genome map
AA seq 280 aa AA seqDB search
MCRHLGYVGAPVAVGELLTRGTHSLREQSWAPREMRGGGTINADGFGAAWWRPATDGVAV
SRYRNREPIWSDPAVTEVLGQLVSPAVLGSVRSATVGMPIERSACAPFTTGRWAFSHNGV
VPRWRQVLSAVSADLDVAATRSGATRLFETARLLDAEAATDAATLWVLLADLIASAESGG
YGDDPETAVRLLVEAVLRHEPAARLNFLLCDGTRLLATTVYHSLSALVTDEFAILSSEPY
DDDPRWQPIPDHCLVRAEPGRLAVEPLTGVPAAHTERPLA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgtcatctcggctacgtgggtgcgccggtcgccgtcggcgaactgctcacccgg
ggcacgcattcgctgcgcgagcagtcctgggcgccgcgggagatgcgcggcggcggcacc
atcaacgccgacggtttcggcgcggcgtggtggcgccccgccaccgacggcgtggccgtg
agccgctatcgcaaccgggaaccgatctggagcgacccggcggtgaccgaagtgctcggc
cagctggtctccccggccgtactgggttcggtgcggtcggcgacggtcggtatgcccatc
gagcgcagcgcctgcgcaccgttcaccaccggccgctgggcattcagccacaacggtgtg
gtgccgcgctggcggcaggtgctcagcgcggtctccgccgacctggacgtggcggcgacc
cgttcgggggcgacgcggctgttcgagacggctcgcctgctcgacgccgaggcggcgacc
gacgccgccacgctgtgggtgctgctggccgacctgatcgcctccgccgaatccggcggg
tacggcgacgaccccgagaccgccgtgcggctgctggtcgaagcggtgctgcggcacgaa
ccggccgcgcggctgaacttcctgctctgcgacggcacccggctgctcgccaccaccgtc
taccactcgctgtcggcgctggtcaccgacgagttcgcgatcctgtcctccgagccctac
gacgacgacccgcgctggcagccgatccccgatcactgcctggtccgggcggagccgggc
cggctcgccgtcgaaccactcaccggcgtccccgccgcgcacaccgaaaggccgctcgca
tga

DBGET integrated database retrieval system