KEGG   Nocardia farcinica NCTC11134: ERS450000_05825Help
Entry
ERS450000_05825   CDS       T04524                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00860  Porphyrin and chlorophyll metabolism
nfr01100  Metabolic pathways
Module
nfr_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ERS450000_05825 (cobQ)
Enzymes [BR:nfr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     ERS450000_05825 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DJ-1_PfpI SNO GATase
Motif
Other DBs
NCBI-ProteinID: CRY84035
UniProt: A0A0H5P8A7
Position
p2:2495721..2497283
Genome map
AA seq 520 aa AA seqDB search
MKGALLVAGTTSDAGKSVVVAGLCRMLARRGVRVAPFKAQNMSNNSVVTLDGGEIGRAQA
LQARACGLEPSVRFNPVLLKPGSDRRSQLVVRGQAVDTVGAADYFRHRTALREVVAAELA
SLRAEFDVVLCEGAGSPAEINLRATDLANMGLARAADLPVLVVGDIDRGGVLAHLFGTVA
VLEPDDQRLIAGFVVNKFRGDVDLLRPGLDRLAELTGRPTLGVLPFAEELWLDAEDSLGT
VADAPVGRPRPPVGTEWLTVAAVRLPRISNSTDVEALACEPGVAVRWVSEPSRLADADLV
VVPGSKSTVSDLAWLRRTGLGEALRARVAAGRPVLAICGGYQMLGRRIVDEVESGAGEVA
GLGVFDLETEFAAPKVLRRVTGVGAGNPVRGYEIHHGRVRRSGDAPWLGLVDAPEAAVDG
GEDAVPLSPEGSVTGGAWGTHVHGLLESDGFRRAWLREVAARAGRHGFQVAPDTSVAAVR
AGQLDLLADLVEKHLDQDALERILTDGAPTGLPVLTVGQA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggcgcgctgctggtcgcgggcaccacctccgacgcgggaaagagcgtggtggtg
gccgggctgtgccggatgctggcgcgccgtggcgtgcgggtggcgccgttcaaggcgcag
aacatgtccaacaactccgtggtcaccctcgacggcggggagatcggccgcgcccaggcg
ttgcaggcccgcgcgtgcgggctcgaacccagcgtgcggttcaacccggtgttgttgaaa
cccggcagcgaccggcgctcgcaactggtggtgcgcggtcaggccgtcgacaccgtcggc
gccgccgactacttccgccaccgcaccgccctgcgcgaggtcgtcgccgccgaattggct
tcgctgcgggccgaattcgacgtggtgctctgcgagggcgccggttcgcccgcggagatc
aacctgcgcgccaccgatctggcgaacatggggctggcccgcgccgcggacctgccggtg
ctcgtcgtcggcgacatcgaccgcggcggcgtgctggcccacctgttcggcaccgtggcc
gtgctcgagcccgacgaccagcggttgatcgccggcttcgtggtcaacaagttccgcggc
gacgtcgacctgttacggcccgggctcgaccggctcgccgaactcaccggcaggcccact
ctcggcgtcctgccgtttgccgaggagctgtggctggacgccgaggattcgctcggcacc
gtcgccgacgcgccggtcggccggccgcgcccgccggtggggaccgagtggctgacggtc
gcggcggtgcggttgccgcgcatctccaactccaccgacgtggaggcgctggcctgcgaa
cccggcgtcgcggtgcgctgggtgagcgagccctcccggctcgccgacgccgatctcgtc
gtggtgcccggcagcaagtcgaccgtctcggatctggcgtggttgcgccgcaccggtctc
ggcgaggcgttacgggcgcgggtggccgcgggccggccggtgctcgcgatctgcggcggg
taccagatgctcgggcggcgcatcgtggacgaggtcgagtccggggcgggcgaggtcgcc
gggctgggcgtgttcgacctggagaccgagttcgccgcgccgaaggtgctgcggcgggtg
accggggtgggcgcgggaaacccggtgcgcgggtacgagatccaccacggccgggtgcgc
cggtccggcgatgcgccgtggctcgggctcgtcgacgcaccggaggcggcggtcgacggg
ggcgaggacgccgtgccgctgtcgccggaagggtccgtgacgggcggggcctggggcacc
cacgtgcacgggctgttggagagcgacgggttccgccgcgcctggttgcgggaggtcgcc
gcgcgcgccggtcgccacggcttccaggtggcgcccgacacctcggtggccgccgtgcgc
gccggacaactggacctgctcgccgatctggtcgagaagcacctcgatcaggacgcgctc
gagcggatcctcaccgatggtgcgcccaccgggctcccggtgctcaccgtcgggcaggcg
tag

DBGET integrated database retrieval system