KEGG   Nothobranchius furzeri (turquoise killifish): 107373220
Entry
107373220         CDS       T05163                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00230  Purine metabolism
nfu00240  Pyrimidine metabolism
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107373220
   00240 Pyrimidine metabolism
    107373220
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107373220
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_33 AAA_28 AAA_17
Other DBs
NCBI-GeneID: 107373220
NCBI-ProteinID: XP_015796873
UniProt: A0A1A7ZD94
Position
Unknown
AA seq 262 aa
MATPPKRPCDGSNSFSRRHKKISIEGNIAAGKSTFVRLLQTASEEWEVIPEPIGKWCNVQ
NDSEDIYQDLSSSQKSGGNLLQMLYDKPSRWSYTFQSYACLSRVRAQLQGPSAKLQQAEN
PVQFYERSVYSDRYVFASNLFECGDLTDTEWSVYQDWHTWLLNHFEPDITLNGIIYLRAS
PQRCMQRLMHRGRDEERGIPLEYLEQLHSKHEAWLYHKNLRLDFDYLSELPVLVLDVDDD
FKNDQIKQEAIIDKVQEFLTLL
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcgactccaccgaagagaccttgcgacggctccaacagcttttcccgccgacataag
aagatctctatcgagggcaacatcgctgcaggtaaatccaccttcgtgcgcctcctgcag
acagcatctgaagaatgggaggtgattcctgaaccaatcgggaagtggtgcaatgtgcag
aatgacagtgaggacatttaccaggacttgagctcgtctcagaagagtggaggaaacctg
ctgcagatgttatacgataaacccagccgttggtcctatacttttcagagctatgcgtgt
ctcagcagagttcgagctcagcttcagggtccatccgctaaacttcagcaggcagaaaac
ccggttcagttctacgagcgctccgtttactcagacaggtatgtgtttgcatccaacctc
tttgagtgtggagacctgactgacaccgagtggagtgtttatcaggactggcacacctgg
ctattgaaccactttgaacccgacatcaccctgaatggcatcatctacctgagagcctct
ccacagcgctgtatgcagaggctgatgcatcgcggcagggatgaggaacgggggattccc
ctcgagtatctggagcagcttcactccaaacacgaggcgtggctctaccacaagaacctc
aggctggactttgattacctcagtgaacttcctgtcctcgttctggatgttgatgacgac
ttcaagaatgaccaaataaaacaagaagctatcatcgataaggttcaagaatttctcacg
ttgctgtga

DBGET integrated database retrieval system