KEGG   Nothobranchius furzeri (turquoise killifish): 107373583Help
Entry
107373583         CDS       T05163                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00232  Caffeine metabolism
nfu00983  Drug metabolism - other enzymes
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    107373583
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107373583
Enzymes [BR:nfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     107373583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 107373583
NCBI-ProteinID: XP_015797198
Position
Unknown
AA seq 297 aa AA seqDB search
MFQAKGMMNLKEYFQRIGFHGRYDKVDLPTLTLIHKLHVMSIPFENLSIHCGERITMDLE
LIFNKIVRSCRGGWCLENNFLFGWVLREMGFSAMTLSSRVFNSMLGDFGPLDSHLIHKII
IDEKAYIADVSFGVSSQIREPLELISGNYQIQAAGVFRLIDKGNIWVLEKTGRKQEVLNA
EFATSSLVNRKETKQIYCFTLEPRESEYFIDKSNRLQTDPASLFTNKSICSLQTPSGFRA
LIGWTFSEVTFKPHKGVDVLYMRNTTDDEIEQVLKELFGIKLQRKLKPVSNKTFYTL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggctaaaggtatgatgaatttgaaggagtacttccaacggatcggtttccat
ggccgttatgataaagtggatctcccaaccctgacgttgatccacaaactgcacgtcatg
tcaattccttttgaaaacctcagcattcactgtggtgagaggatcaccatggatctggag
ctgattttcaataagattgtgaggagttgtcggggaggctggtgcctggagaacaacttc
ctgtttgggtgggtgctgagagagatgggcttcagtgccatgacgttgagctctagagtt
ttcaacagtatgcttggtgactttggtcctcttgattctcatctcattcacaaaatcatc
attgatgagaaggcttacatagctgatgtcagctttggggtgtcgtcacagatacgggag
ccgctggagctcatttcaggaaattatcaaatccaagccgcaggagtgtttcgtctcatt
gacaaggggaacatctgggttctggagaagacaggtagaaagcaagaagttctcaatgca
gaatttgccacatccagcctcgtgaacaggaaggagactaagcagatctactgcttcacc
ctggagccacgcgagtcagaatattttatcgataaaagcaacagacttcagacagatcct
gcctcgctcttcactaataagtccatctgctcgctgcagacgccatcaggattcagggct
ctgattggctggaccttcagcgaggtcacattcaaaccccataaaggtgtcgatgtctta
tacatgagaaacacaactgatgatgagatagagcaagttctgaaggaactgtttggtata
aagttgcagagaaaactgaaacctgttagcaacaaaacattctacacactctaa

DBGET integrated database retrieval system