KEGG   Nothobranchius furzeri (turquoise killifish): 107374334Help
Entry
107374334         CDS       T05163                                 

Definition
(RefSeq) TGF-beta receptor type-1-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04060  Cytokine-cytokine receptor interaction
nfu04068  FoxO signaling pathway
nfu04144  Endocytosis
nfu04218  Cellular senescence
nfu04350  TGF-beta signaling pathway
nfu04371  Apelin signaling pathway
nfu04520  Adherens junction
nfu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107374334
   04350 TGF-beta signaling pathway
    107374334
   04371 Apelin signaling pathway
    107374334
   04068 FoxO signaling pathway
    107374334
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107374334
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107374334
  09143 Cell growth and death
   04218 Cellular senescence
    107374334
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107374334
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107374334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107374334
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107374334
Protein kinases [BR:nfu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107374334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 107374334
NCBI-ProteinID: XP_015797966
Position
Unknown
AA seq 503 aa AA seqDB search
MGVLPCLLLVLLFGTRIQENAALQCHCDRCSANSSCTTDGVCFVAVRRSGSQLITEGRQC
VPEVELIPRDRPFICAPSSKLDTGVYPTCCNWDFCNKEPNIGPPTPPTKSTPPMGPVALA
AVIACPVCVLCLLLVLAFYICHHRGLGAGGAGALHHRVPNEEDPSMDHPFITVGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLSLSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIASRCSVGGI
HEDYQLPYYDLVQSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtactaccatgccttctgctcgtcctcctgttcgggacaaggatacaagaaaac
gctgcccttcagtgtcactgtgatcgctgcagcgccaactccagctgcacgacagatggc
gtctgcttcgtggccgtcaggaggtcaggtagtcagctgattacggagggacgccagtgt
gttcctgaagttgaactgattcctcgtgaccggcccttcatctgtgctccatcttccaag
ctggacactggtgtctacccgacctgctgcaactgggacttctgcaacaaggagccaaac
atcggccctccgaccccacccaccaaaagcacacccccaatgggccccgtggcccttgca
gctgtcattgcttgcccagtatgcgtgctctgcctgctgctggtcttggcattctacatt
tgccaccatagaggtctgggggctggaggagctggagccctccaccatcgtgtgcccaat
gaggaggacccctccatggaccacccctttatcactgttggaacaacgctgaaagacctc
atctacgacatgaccacctcaggctctggatcagggctacccctgctggttcagaggacc
atagccagaaccatcatcctccaggagagcatcgggaaggggcgctttggggaagtgtgg
cgtggaaaatggcgcggtgaggaggttgcagtgaagattttctcctccagagaagagcgg
tcctggtttcgtgaggccgagatctaccagacggtgatgctgaggcatgagaacatcctg
ggcttcattgctgctgacaacaaagataatgggacctggactcagctgtggctggtgtct
gactaccacgaacacggctccctgttcgactacctgaaccgctacaccgtcaccgtggag
gggatgatcaagctgtccctgtccaccgccagcggcctggcccacctccacatggagatc
gttggaacacaaggtaaaccagcgattgcacacagagacctgaagtcaaagaacatcctg
gtgaagaagaacgggacctgctgcattgcagacctgggccttgcggtgcgacacgactcc
gccaccgacaccatcgacatcgctcccaaccacagagtgggaaccaaacggtacatggct
ccagaggtcctagacgactccatcaacatgaagcactttgagtcgttcaagcgagctgac
atttacgccatgggcctggtgttctgggagatcgccagccgctgctctgtgggaggcatt
cacgaggactaccagctgccctactacgacctggtccagtcagatccttcagtagaggag
atgaggaaggtggtgtgtgagcagaagcttcggccgaacattcccaaccgctggcagagc
tgcgaggcgctgcgggtgatggcaaagatcatgagggagtgttggtacgccaacggtgct
gctcgcctcacggctctacgaatcaagaagactttgtctcagctcagccagcaggaggga
atcaagctgtag

DBGET integrated database retrieval system