KEGG   Nothobranchius furzeri (turquoise killifish): 107375298
Entry
107375298         CDS       T05163                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107375298
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     107375298
SSDB
Motif
Pfam: AstE_AspA DUF4539
Other DBs
NCBI-GeneID: 107375298
NCBI-ProteinID: XP_015799238
Position
sgr02
AA seq 311 aa
MQKMELESFSPVSTVAVCGGTHGNELTGVYVVREMQKQKVEKVGLTSVDVVLTNPRAVAL
GRRYAEMDLNRCFSDAHLSSPLTESSVYEVRRAQELNAQLGPKGSEAAVDLLIDLHNTTA
NMGVCLLFYSIDWLTLHIYRYIKNKMSPLPVRAIDVGVPISDAYSLEAVGKHGFAIEVGP
QPNGVLRADIFNMMKKTVDLTMDWIQEFNSGCTFEAGEVEVFTVVKSVDYPRDQTGEITA
TIHPELQDNDFKLLRRGDPVFLSFTGETVEHEGDELHPFFVNECAYYEKKIAFHLGQKTT
FQLPPVCMKKN
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcagaagatggagctcgagtctttctcaccggtgtccaccgttgctgtttgtggtggg
acacacggaaatgagctgacgggggtttacgttgtgagagaaatgcagaagcagaaggtg
gaaaaggtgggattgacttcagtagatgttgttctgacaaatccgcgggccgttgccctc
ggtcgaagatacgccgagatggatctcaaccgctgtttcagtgacgcccacctgagttcc
cctctgacagagtcaagtgtgtatgaggtgaggcgagctcaagagctgaatgctcagctg
ggacccaaaggaagtgaggcggcggtagatctactcatagacctgcacaacacaaccgcc
aacatgggcgtgtgcctcctcttctactccatagactggctcaccctgcacatctacagg
tacataaagaacaaaatgtctcctttgcccgtaagagcaattgatgtgggcgttccaatt
tctgatgcttactccctggaagcagtgggaaagcatggattcgcgatagaagttggccct
cagcccaacggcgtcctcagggctgacatcttcaacatgatgaagaaaacggtggacctc
acaatggactggatccaggagtttaactctggatgcacttttgaagcaggcgaggtggaa
gtgttcactgtggtaaaaagtgtggactacccaagggaccagactggtgaaatcaccgct
actatacaccctgagctgcaggataatgattttaagctcttgcgccgcggggatccagtg
ttcctgtcgtttaccggagagacggtggagcacgagggagacgagctccacccgttcttt
gtgaatgaatgtgcctactatgagaagaagattgctttccacttgggtcagaagacaact
ttccaactgcctcctgtttgcatgaagaagaactga

DBGET integrated database retrieval system