KEGG   Nothobranchius furzeri (turquoise killifish): 107375709Help
Entry
107375709         CDS       T05163                                 

Definition
(RefSeq) transmembrane protein 150A-like
  KO
K21846  transmembrane protein 150
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nfu04131]
    107375709
Membrane trafficking [BR:nfu04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    107375709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frag1 DUF998 BCHF
Motif
Other DBs
NCBI-GeneID: 107375709
NCBI-ProteinID: XP_015799875
UniProt: A0A1A8V8A9
Position
sgr03
AA seq 281 aa AA seqDB search
MSRWMILPISLPVLSITGIWVVYAMALYNQHVCPIDNWLYNQSCEEELQTQIGPPFCCTL
DNIPFISKCGTLPPESCFFSLICSMGSFMVMMIVSLRYAHVIEKHQNCILNTASLSTGWI
CSAGLMMVGNFQVDNAKILHYVGAGVTFPTGILFVCLQSALTYRLAKTQGEYYLAHLRLC
VTLLAFVALVLSGVFFCQESFALQHASAIFEWVFCVIIMLFYGTFAFEFASLSGDTMVIL
AKGGPQGSSAREHKMEALGGLGGPVPHSQPHLHQPETMSIL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgctggatgatactgcccatcagccttccagtcctgagcatcactgggatttgg
gttgtctacgccatggctttgtacaaccagcacgtctgccctatagacaactggttgtac
aaccagtcgtgtgaagaggagctacaaacccagattggaccacctttctgctgcacatta
gataacatacctttcatcagtaaatgtgggactcttccccctgagagctgcttcttcagc
cttatctgcagcatgggctcattcatggttatgatgattgtgtcgcttcgctacgcccac
gttatcgagaagcaccagaactgtatcctcaacacggcgagtctgtccacgggctggatc
tgttctgctggactcatgatggtgggaaacttccaggtggataacgccaaaattctccac
tatgtcggagcgggcgtcaccttccccaccggcattctgtttgtgtgcctccagtcggcg
ctgacctaccgactggccaagacccaaggggagtattacttggctcacctccggctctgc
gtgaccctcctggccttcgtagccttggtgctcagtggcgtgttcttctgtcaggagagc
tttgccctgcagcacgcctcggctatcttcgaatgggtgttctgtgtcatcatcatgctc
ttttacgggacgtttgcattcgagtttgctagcctttcaggagacaccatggtgattctg
gccaagggaggcccccaaggatcttctgcgagagaacataaaatggaagcactgggtgga
cttggaggaccagttccacactcacaaccacatctgcaccaacccgaaaccatgtctata
ctgtag

DBGET integrated database retrieval system