KEGG   Nothobranchius furzeri (turquoise killifish): 107376031Help
Entry
107376031         CDS       T05163                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00010  Glycolysis / Gluconeogenesis
nfu00562  Inositol phosphate metabolism
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107376031
   00562 Inositol phosphate metabolism
    107376031
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107376031
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107376031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107376031
NCBI-ProteinID: XP_015800401
UniProt: A0A1A8U7M4
Position
sgr03
AA seq 463 aa AA seqDB search
MITLWGNIFIPFTIITGLSCFRHDVVPEENPNIPPIAKYFCTKGRYEEVNPYLIEDILAV
NRSILQPPAPQCHEIHLTAIIRHGTRYPTAKNVKKMRKFYNLVRSSATGTHNWLREIQNL
WAMWYTEDMDGRLVQKGVEDLKHLAIRLSKLFPSMISEEKLRNGLIKFITSSKHRCVNST
LSFQAGLTSLWDIADVEFGHEMNDALMRFFELCHKFVQEVDSNPSAMTELDKFSKGLEMM
RVQQKIADRLEVPYNLITDDMVEAAFYLCAYEFAIKTVNSPWCRLFDEVDAQVMEYAIDL
KQFWKRGYGYDINSKSSCILFHDVFSRLDKAVKEKQSGEQVSEAVTVQVGHAETLLPLFT
LLGFFKDTDPLTSANYATQTQRSFRTSQMLPYAANFVMVLYDCGGGDFRLQPLLNENPVA
FPGLTNQQASMPLYQDVKQHYSDLLNGCDFETECQLFKGPSEV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgatcactttatggggaaacatttttattccctttaccatcataactggcctctcttgt
tttcgacacgatgtggttccggaagaaaacccaaatattccgccaatcgctaaatatttc
tgtacgaaaggcaggtatgaggaagtcaacccgtatctcatagaggacattcttgcggta
aacagatctattttgcagcctccggccccgcagtgccacgagatccatctgaccgctata
atccgacatgggacgagatacccgacggccaaaaatgtcaagaagatgcggaagttttac
aatctggtccggagcagcgcgacaggcacgcacaactggctgcgtgagatccagaacctg
tgggcgatgtggtacaccgaggacatggacggccgactggtccagaaaggggtagaagac
ctcaaacatctggccatacggctgtctaaattgttcccctccatgatttcagaggagaag
cttcgaaatggactcatcaagttcatcaccagctccaagcacagatgcgtcaacagcacg
ctgtccttccaggccggactgacgagcctgtgggacattgcagatgtggagtttggtcat
gaaatgaacgatgcccttatgaggttctttgagctgtgtcacaaatttgtgcaggaagtt
gatagcaacccatctgcgatgacagagctggacaagttcagcaagggcctagagatgatg
agggtccagcagaagatagcagacagactggaagtcccatacaacctcatcacagatgat
atggtggaagcggcgttttacctgtgtgcgtatgagtttgccatcaaaactgtgaattcc
ccgtggtgtcggctctttgacgaagttgatgcacaggttatggagtacgcaattgatctg
aagcaattctggaaacgaggctatggatacgacataaacagcaaatccagctgcatcctg
ttccatgatgtgttcagccgtctggacaaagcagtcaaagagaagcaatcgggtgagcag
gtgagcgaagcagtgacagtgcaggtcggccatgctgagaccctcctcccactttttacc
cttttgggcttcttcaaggacacagatccccttacatcagcaaactacgccacgcagacc
cagcgctctttccgcaccagccagatgttgccatacgctgctaacttcgtcatggttctg
tatgattgcggagggggcgactttagactgcagcctctgctcaatgagaacccagtggcc
ttcccaggtctaaccaaccagcaggcatcaatgccgctctatcaagatgtcaaacagcac
tacagtgatctgctcaatggttgtgactttgagacagaatgccaactgttcaaaggtcct
tctgaagtgtag

DBGET integrated database retrieval system