KEGG   Nothobranchius furzeri (turquoise killifish): 107376517Help
Entry
107376517         CDS       T05163                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04260  Cardiac muscle contraction
nfu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107376517
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107376517
   04261 Adrenergic signaling in cardiomyocytes
    107376517
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nfu04040]
    107376517
Ion channels [BR:nfu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107376517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 DUF716 DUF4199 Serinc
Motif
Other DBs
NCBI-GeneID: 107376517
NCBI-ProteinID: XP_015801129
UniProt: A0A1A8AQW4
Position
sgr03
AA seq 276 aa AA seqDB search
MSACSRKALTLLSSVFAISGLGLLGVAVSTDYWLYLEEGVIMPLNQTTDIKASLHSGLWR
VCFLAGEESGRCFNIEYIMPMNIKLTSEATGNILKMIRSATPFPLVSLLFMFIGFVLSNI
GHIRPHRTILAFVSGIFFILSGLALVVGLVLYISSINDEILNRTKSSEAFFSYKYGWSFA
FAALSFLLTESAGVMSVYLFMKRYAAEELYQPRHPNFYRPRLSNCSDHSGQFLHPEAWSR
GRSPSDISSEASLQMSASYPALLKCPDYDQVLSSPC
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgtgcagcaggaaggctctgactttactcagcagtgtctttgcaatcagtggc
ctgggtctgctgggagtggcagtgagcacagattactggctgtacctggaggagggcgtc
atcatgcctctgaaccagaccaccgacatcaaggcttctctgcactctggcctctggaga
gtctgttttctggccggtgaggaatcgggccgctgcttcaacatcgagtacatcatgccc
atgaacatcaagctgacgtcagaggccacagggaacattctcaagatgatccgctcagcg
actccgttccctctggtcagcctcttgttcatgttcatcggttttgttctcagcaacatt
ggacacatccgtcctcatcgcaccatcctggcgtttgtctcaggaatcttcttcatcctt
tcaggactagccctggtggtgggtctagtgctctacatctccagtataaatgatgagatt
ctgaacaggacgaagagcagcgaggccttcttctcctataagtacggctggtcctttgcc
ttcgctgcgctctccttcctgctcaccgagagtgcaggcgtcatgtctgtctacctgttc
atgaagcggtacgcagccgaggagctctaccagccacgccaccctaacttctaccggccg
cgcctcagtaactgctccgaccactctggccagttcctccacccagaggcctggtcacgt
ggaaggagcccctcagacatctccagtgaagcctcactccagatgagcgccagctaccca
gctctccttaaatgtcccgactacgaccaggtgttgtcctcaccctgctga

DBGET integrated database retrieval system