KEGG   Nothobranchius furzeri (turquoise killifish): 107377069Help
Entry
107377069         CDS       T05163                                 

Gene name
nop58
Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    107377069 (nop58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nfu03009]
    107377069 (nop58)
Ribosome biogenesis [BR:nfu03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    107377069 (nop58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT Cas_Cas1
Motif
Other DBs
NCBI-GeneID: 107377069
NCBI-ProteinID: XP_015801955
Position
sgr04
AA seq 567 aa AA seqDB search
MLVLFETAAGYAIFKVLNESKLQQVDSLYKEFETPEKANKIVKLKHFEKFQDTTEALAAA
TALVEGKISKSLKKILKKVVAKEAHEELAISDAKLGGVIKDKLDLNCVYSPAVAELMRCI
RSQMESLISGLPPREMSAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY
IMRCREWYGWHFPELGKVVTDNLAYCKTVLKVGDRTNVSSTDLSEILPEEIEAEVKLAAE
ISMGTEVSEQDIDNIRHLCDQVIEISEYRAQLYDYLKNRMMAIAPNLTVMVGELVGARLI
SHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGLIYHASLVGQTTAKNKGKIS
RMLAAKAALAIRYDALGEDTNAEMGAENRAKLEARLRHLEDKGIRRISGTGKAMARADKY
QHKSEVRIYDPSGDSTIPSTSKKRKIEEVEEETPEPVTPVVKAKKIRKEPETEETETAAE
AAEPPKKKKKKKDKSAAELEEPKEEEEEVAVSETTGKKKKKKKDKSVRELQEPKEEPKEE
EEEEVAVGETSEKKKKKKKKVKEEEDE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttctatttgaaaccgccgctggatatgcgatattcaaagtcctaaatgaatca
aagctgcagcaggtggacagcctgtacaaggagtttgagactcctgaaaaagccaacaaa
attgtgaaactgaaacactttgagaagtttcaggacacgacggaggcactggcagctgcc
accgctctggttgagggaaaaatcagcaaaagtttgaagaagatcctgaagaaagtcgtg
gccaaggaggctcatgaggagctagccatcagcgatgctaaactgggtggagttattaaa
gacaagctggacctgaactgcgtctacagccccgcagtagccgagctgatgagatgcatc
aggagccagatggagagtctgatctctggacttcctcccagagagatgagcgccatgtct
ctgggcttggctcacagtttgtcccgctacaagctgaagttcagcccggacaaagtggac
acgatgatcgttcaggccatttccctcctggacgacctggacaaggagcttaataactac
atcatgcgctgcagagagtggtacggctggcacttccccgagctggggaaggtcgtcacg
gacaacctagcttactgcaaaaccgtcctcaaagtcggtgatcgtacaaacgtgtccagc
accgatctgtcagaaatcctccctgaggagatcgaggctgaggtgaagctagctgctgag
atctccatgggaacagaagtatccgaacaggacatcgacaacatccggcacctgtgtgat
caggtgattgagatttcagagtaccgcgctcaactctatgactacttgaaaaacaggatg
atggcaatcgcccccaacctgacggtgatggtaggagagctggtgggggctcggctcatc
tcacatgccgggtcactcctgaatctggctaagcacccggcctccacggtccagatcctc
ggagcagagaaggctctgttcagagcgctgaagacccgtaaggacacacccaagtacggt
ctgatttaccacgcctccttagtgggtcagaccacggccaagaacaaaggaaagatttcc
agaatgttagcagctaaagcggcgctagctattcgctatgacgctctaggagaagacacc
aacgcagaaatgggagcagagaaccgagccaagctggaggctcggctgcgccacctagag
gataaaggaatcaggagaatcagtggaacgggcaaagcgatggccagggcagataaatat
cagcataagagtgaagtgaggatttatgacccctctggggactcgaccatcccgtccacc
tccaagaagaggaagattgaggaggtagaggaggagaccccggagcccgtaacaccagtg
gttaaagccaaaaaaatcagaaaggagccagaaacagaagaaactgaaacggcagcagaa
gccgcagagccacccaagaaaaagaagaagaagaaagacaaaagtgcagcagaactggag
gagccaaaggaggaggaggaggaggtagcagtcagtgagaccacagggaagaagaagaag
aagaagaaagacaagagcgtaagagaactgcaggagccaaaggaggagccaaaggaggag
gaggaggaggaggtagctgtcggcgagacctcagaaaagaagaagaagaagaaaaagaag
gtgaaagaagaggaagacgagtga

DBGET integrated database retrieval system