KEGG   Nothobranchius furzeri (turquoise killifish): 107377157Help
Entry
107377157         CDS       T05163                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107377157
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nfu04030]
    107377157
G protein-coupled receptors [BR:nfu04030]
 Rhodopsin family
  Lipid
   Leukotriene
    107377157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 107377157
NCBI-ProteinID: XP_015802078
Position
sgr04
AA seq 379 aa AA seqDB search
MNTTSFPQSSSPGSGSLPVSTSARVGIAILTVAFVLGFPGNMFVVWSVLCRVKKRSVTCL
LVLNLALADAFVLLSAPLFLRYLARMDWEFGTAACKLVHYLSSVNMYVSIYLICLMSMDR
WLAVTRPFLSQRMRTKRSLLVLLLGVWMLAFLLSVPMPFYRSNVKVIKNNFTLRLCMPYH
WRSVGHRSFQYLFETIMGCLVPFSLISTCYSSVICRLQSAKFHRRGKGSRLILMIICAFA
LFWLPYHIVNIIEVVGLLEDSESVTGAALTARPNVTAFAYFSSAVNPLLYVFAGSSHIRQ
AGLSFMGRLFEATNSESRTSSVTRSGRSGSSPDETSVLQTLSVKLGKPFKGKDKERSCSV
AGNETNVPELKTLATVEQL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacctccttcccgcagtcctcctcgcctggctccggctccctgcccgtgagc
acctcagcccgagtcggcattgccatcctgaccgtggcctttgtgctgggtttccctggg
aacatgtttgtcgtctggtctgtgctttgccgagtgaagaagcgttcggtgacgtgtttg
ttggtgctgaaccttgccctggctgatgcctttgtgctgctcagcgcaccgctcttccta
cggtacctggcaagaatggactgggagtttggcacggcggcgtgcaaactggtccattac
ctgtcgtccgtgaatatgtatgtgtccatctacctcatctgtctgatgagcatggaccgc
tggctggctgtcacaaggcctttcctgtctcagaggatgagaaccaagcgttccctgctg
gttctcctgttgggggtgtggatgttggcgttcctcctgtcagtgccgatgcctttctac
cgcagcaacgtgaaggttataaagaacaacttcaccttaaggttgtgcatgccataccac
tggcggagtgtgggccaccggagctttcagtacctgtttgagaccatcatgggctgcctg
gtgcccttctccctcatcagcacgtgttactcctccgtcatctgcagactgcaaagcgcc
aagtttcatcgcagaggaaaaggcagccgcctgatcctgatgatcatctgtgcctttgcg
ttgttctggctgccctatcacattgtcaacatcatcgaggtggtgggcctcctagaagac
agtgaatcagtgactggggcagctctcacagcccgacccaacgtcacagccttcgcttac
ttcagcagcgccgtcaaccccctcctttatgtatttgctggtagctcccacatccgccag
gccgggctgagcttcatgggcagactgtttgaggctaccaactcagagagcaggacgtcc
tccgtcacccgcagcgggcggagcggctcgtctccagacgagacctcggtactgcagacg
ctgtccgttaaactcgggaagcctttcaaaggcaaggataaggagaggagctgcagcgta
gcgggcaatgagaccaacgtgccagagctcaagactctggcaactgtcgagcagctctaa

DBGET integrated database retrieval system