KEGG   Nothobranchius furzeri (turquoise killifish): 107377547Help
Entry
107377547         CDS       T05163                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04060  Cytokine-cytokine receptor interaction
nfu04068  FoxO signaling pathway
nfu04110  Cell cycle
nfu04218  Cellular senescence
nfu04350  TGF-beta signaling pathway
nfu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107377547
   04350 TGF-beta signaling pathway
    107377547
   04068 FoxO signaling pathway
    107377547
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107377547
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107377547
   04218 Cellular senescence
    107377547
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107377547
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nfu04052]
    107377547
   00536 Glycosaminoglycan binding proteins [BR:nfu00536]
    107377547
Cytokines and growth factors [BR:nfu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107377547
Glycosaminoglycan binding proteins [BR:nfu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107377547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 107377547
NCBI-ProteinID: XP_015802702
UniProt: A0A1A8A3G2
Position
sgr01
AA seq 422 aa AA seqDB search
MWFSCLPLLLMLLRFSGVLLLVEGINTCQSINLEAQKSRRIEAVRGQILSKLRIRSPPDD
DDDDPPSSSVPPEVMLLYNSTRELMKERARLAESACERESSEEDYYAKEVQRIDMLPPRT
DSNTVQPATPSPYYRVVQFDVGGVDLINSTLVKAEFRIFRAPNPQARASEQRVELYQLLR
PEEDSTSTQRYIDSRTVQPRAKGTWISVDVTETIKDWVSDPENNLGLKLGVHCPCCTFVP
STNNIVPNKSEELEALFAGVDDERLRQLRKPGQIKGQADFSTKTPHLILTLLPSDRVDNL
AKKSRKKRAAATDTTTCSRGSDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPY
LWSVNNHYNMILPLYNKLNPEASASPCCVPQDLEPLTIMYFVGRTPRVEQLSNMVVKSCK
CR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtggttctcttgcctcccgctgcttctgatgctgctccggttctccggtgtgctgctg
ctggtggaggggatcaacacgtgccagtccatcaacctggaggcgcagaagtcccggcgc
atcgaggcggtccgcggacaaattctcagcaagctccgcatccgcagtccgccggacgac
gatgacgacgaccctccgtcaagctccgtacccccggaggtcatgctgctctataacagc
acacgggagctgatgaaggagcgcgcgcggctggccgagtctgcgtgcgagcgcgagagc
agcgaggaggactattacgccaaagaggtgcagaggattgacatgctgcccccccgcacc
gactcaaacaccgtgcaacctgcaacacccagcccctattacagagtcgtccaatttgac
gtcggtggggtcgatctgatcaacagcaccctggtcaaagctgagttcaggatcttcaga
gctcccaacccgcaggctcgggcctcggagcagagagtggagctttatcagctactgaga
ccagaggaggacagcacctccacccagcgctacatcgactcccgcaccgttcagcccaga
gctaaaggaacctggatctctgtggacgtcacagagaccattaaagactgggtgtcggac
ccagagaacaaccttggcctgaagctgggcgtgcactgtccctgctgcaccttcgtcccg
tccaccaacaacatcgttcccaacaagagcgaggagctggaggcgctgttcgctggtgtg
gacgatgagaggcttcgtcaactgagaaaaccaggtcagattaaaggtcaggcagacttc
agcaccaagacaccacacctcatcctcaccctgctgcccagtgacagagtggacaaccta
gccaagaagagccgaaagaagagggctgccgccacagacaccacaacctgctcccgtggc
tcagatcagggctgctgtctgcgctcactctacatcgacttcaggcgtgacctcaactgg
aagtggatccacgagcccaaaggttacaaggccaatttctgcgccggcaactgtccgtac
ctctggagtgtcaacaaccactacaacatgatcctgcctctgtacaacaagctgaaccca
gaggcctcagcgtcgccctgctgtgtccctcaggacctggagcccctcaccatcatgtac
ttcgtaggccgaacaccacgcgtggagcaactctccaacatggtcgtcaaatcctgcaag
tgccgctga

DBGET integrated database retrieval system