KEGG   Nothobranchius furzeri (turquoise killifish): 107377998Help
Entry
107377998         CDS       T05163                                 

Gene name
fkbp6
Definition
(RefSeq) inactive peptidyl-prolyl cis-trans isomerase FKBP6
  KO
K09572  FK506-binding protein 6 [EC:5.2.1.8]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nfu03110]
    107377998 (fkbp6)
Enzymes [BR:nfu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107377998 (fkbp6)
Chaperones and folding catalysts [BR:nfu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    107377998 (fkbp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_2 TPR_19 TPR_11 TPR_1
Motif
Other DBs
NCBI-GeneID: 107377998
NCBI-ProteinID: XP_015803473
Position
sgr04
AA seq 323 aa AA seqDB search
MPLNGLVPTSARMRPSVTPFQLLMQRMDDVLGDGGILKEVVHPGEGPPVPLNASVLMYYS
GFLEYSDQPYESNTYIKHPPLMKLGKEVTLAGLEMGLLTMKRGEFSRFLFQPRYAYGDMG
CPPLIPASATILYEVQLLDYLDSGLVDDYVARSPEEQNAVSFPMFLTVVNTLRSFGNRCF
NQSRYENAKDNYKRAATLLGNRTAQSEPEKEKIKAALLPLHLNCSLTELRLENPRRALKY
GKKALAIDATNTKALYRCGQAYMELSEYECAQSCLISAQARKPFDSDINNLLRKVAMCYK
SSLDKEKDIYSKMFSKVTAPEKM
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaacggtttagtaccgacttctgcaaggatgcgcccttctgtgactcccttt
cagctgctaatgcagcggatggacgacgttttgggggacggagggatcctgaaggaggtg
gtccacccaggagagggtccacctgtgcctctaaatgcttcagtattgatgtattattct
gggtttctggagtattctgatcagccttatgaatccaacacctacatcaagcacccccca
ctgatgaagcttgggaaagaggtgacattagctggactggagatgggtctgttgaccatg
aagagaggggagttctcacgcttcctcttccagccccggtatgcctacggagacatgggc
tgtcctccattgatccctgcttcagccacgatcctgtacgaggtccagctcctcgactat
cttgactcaggattggttgatgattatgtcgcgaggagtccggaggaacagaatgccgtt
tctttccccatgttcctcaccgtcgtcaacacactgcgcagcttcggcaaccgctgtttc
aaccagagccgatatgaaaacgccaaagataactataaacgggcagcaactctgctggga
aaccgaacagcacagagtgaaccagagaaggagaagatcaaggcggctctgctgcctctc
catctgaactgttctctcaccgagctccgcctggagaacccacgcagagccctcaagtac
ggcaaaaaagccttagcgatagatgctaccaacacaaaggctctttaccgctgtggacag
gcttacatggagctgtctgagtatgagtgtgctcagagttgcctcatttctgctcaagcg
aggaagccgtttgactccgacatcaacaaccttctgaggaaagtggcgatgtgctacaaa
agcagcttggataaagagaaggacatttactcgaagatgttcagcaaggtgacggctcct
gagaagatgtga

DBGET integrated database retrieval system