KEGG   Nothobranchius furzeri (turquoise killifish): 107378029Help
Entry
107378029         CDS       T05163                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107378029
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nfu04030]
    107378029
G protein-coupled receptors [BR:nfu04030]
 Rhodopsin family
  Lipid
   Leukotriene
    107378029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 107378029
NCBI-ProteinID: XP_015803519
Position
sgr04
AA seq 317 aa AA seqDB search
MDQPNSTMATFNFTSSAGPHPSWDSSGLVPAVMLSLVCVLGVPGNIAVIILKPNFARMSS
LSQSLLLNLAISDLLCLMTLPPWIYAFLYGWHFGVVACKLLAYVECCTIYGSLLTVTGLG
IQRYLVVVHRQSCQQTGLLLALLWLVSFTLSTPSLVTRSVKNQLWLDCQDQYSSDSQQIA
SLMTETTFGFLSFIIVAFSYIQIKRTVNQSAFFKHPQTTRLVTSIIVSLFVLWAPYHIVN
ILGVVAICLKNESLLKFYKDTKNIVGSVTFTNSFLNPFLYAFASGKISMRCRKHKPVTQM
ERISQVTEVSTVAELCQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaccaaattccaccatggctactttcaacttcacctcttctgcaggacctcat
ccttcctgggactccagcggtctggttcctgcggtgatgttgtccctcgtctgcgttttg
ggagttcctggaaacatcgccgtgatcattcttaagcccaactttgcgagaatgtccagt
ctgagccagtctttgctgctaaacctggccatctctgatctgctctgcctgatgaccctt
cctccgtggatttatgctttcctgtacggctggcactttggcgtggtcgcctgtaagctt
ctagcatacgttgagtgctgcaccatttacggtagccttctcactgtgaccggactaggc
attcaacgctaccttgttgtcgtgcaccggcagagctgtcaacagactggactgctgctg
gctctgctctggctggtgtctttcaccctgtccactccgtctttggtgactcgaagcgtt
aaaaatcaactgtggctagactgtcaagaccagtactcttctgattcccaacagatagct
tcactgatgacagagaccacgtttggatttctttcctttattattgtggctttttcatac
attcagatcaagagaactgttaaccagtcagcctttttcaaacatccacagacgaccaga
ctggtaaccagcatcatcgtaagcttatttgtcctgtgggctccataccacattgtaaac
attttgggtgtggttgccatttgcctcaaaaatgaaagccttttgaagttttataaagac
acaaagaacattgtaggatcagtaacattcacaaacagcttcctgaatccattcctgtat
gcttttgcatctggtaaaatcagcatgagatgtcgaaaacataaaccagtaacgcaaatg
gaaagaatctctcaggtaacagaagtttctacagttgcagaactttgccagtga

DBGET integrated database retrieval system