KEGG   Nothobranchius furzeri (turquoise killifish): 107378519Help
Entry
107378519         CDS       T05163                                 

Gene name
ngfr
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107378519 (ngfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107378519 (ngfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:nfu04050]
    107378519 (ngfr)
   04090 CD molecules [BR:nfu04090]
    107378519 (ngfr)
Cytokine receptors [BR:nfu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107378519 (ngfr)
CD molecules [BR:nfu04090]
 Proteins
  107378519 (ngfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Chordopox_A13L
Motif
Other DBs
NCBI-GeneID: 107378519
NCBI-ProteinID: XP_015804259
UniProt: A0A1A8VHG5
Position
sgr05
AA seq 387 aa AA seqDB search
MSSRAERLSSPSSSSSSSSQRCILRSRAVLCDSSRRSRMTTKLSLIILCAMVTLARTSKT
ERALFPDCSSGRYTDGGECCLECPPGEGVVKECGATQTVCAQCLDSETFSENDSHTEKCK
PCTQCTGLMRMETPCTDSIDAKCVCNYNYYYNTLSGQCELCTVCPVGQGVYSHCDHHHDT
VCEECVDETYSDRESSLEPCLPCTICDEEMDETLIAECTPNSDSVCHNPNLPTYDPTIAD
PLTYSDAIFPGGSDNPLPNGETTTSSAGSPRFLGHGLNENLIPIYCSILAAVVVGLVAYI
VFKRWNSCKQNKQAANNRAATNNQMVTPEGEKLHSDSGISVDTQSLQEQQQQAQAEVQPQ
PSRTHTQEQIVVSVDGGPHPDSPPPEV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcgtgcagagcggctctcctctccttcttcatcctcctcctcctcctcacag
cgctgcattctccgctctagggctgttttatgtgactccagcagaagaagcaggatgact
actaaactgtcgctgataattttgtgcgcaatggtgacgttggcgaggacatctaagacg
gagcgggctctgtttcccgactgcagctccggccgttacacggacggtggggaatgctgt
ttggagtgtccacctggagagggagtggtgaaggaatgcggcgccactcagaccgtctgc
gctcagtgtttggatagcgagaccttctccgagaacgacagtcacacggagaagtgcaag
ccctgcactcagtgtaccggcttgatgagaatggagacgccgtgcaccgactccatcgac
gcaaaatgtgtctgcaactacaactactattacaatacgctctctggacagtgtgagctg
tgcactgtgtgcccagtagggcaaggcgtgtactctcactgcgaccatcatcatgacaca
gtgtgtgaggagtgtgtggatgagacctactcagaccgggaaagctcccttgagccctgc
ttaccctgcaccatctgtgatgaagaaatggatgagacactgattgctgagtgcacgccc
aacagcgactctgtctgccacaatccgaatctccccacgtacgacccaaccatcgctgat
ccgcttacgtactcagatgccatctttcctggcggctcagacaacccattgccaaatgga
gagacaaccacatccagcgctggctctccccgattccttggccatggcctcaatgaaaac
ctcatccccatctactgctccatcctggctgcggtagtggtgggtctggtggcatacatt
gtgttcaagaggtggaatagctgcaagcagaacaagcaggcagctaataatcgtgctgcc
acaaacaaccagatggtgacaccagaaggtgagaagctgcacagtgacagcggcatctca
gtggacactcagagtcttcaggagcagcagcaacaagcccaggctgaagtccagccgcag
ccttcacgcacacacacacaggagcaaatagtggtgagtgtggatggaggcccccatcct
gactcacctccacctgaagtttga

DBGET integrated database retrieval system