KEGG   Nothobranchius furzeri (turquoise killifish): 107378764Help
Entry
107378764         CDS       T05163                                 

Gene name
ddc
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00350  Tyrosine metabolism
nfu00360  Phenylalanine metabolism
nfu00380  Tryptophan metabolism
nfu01100  Metabolic pathways
Module
nfu_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
nfu_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107378764 (ddc)
   00360 Phenylalanine metabolism
    107378764 (ddc)
   00380 Tryptophan metabolism
    107378764 (ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfu04147]
    107378764 (ddc)
Enzymes [BR:nfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107378764 (ddc)
    4.1.1.105  L-tryptophan decarboxylase
     107378764 (ddc)
Exosome [BR:nfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107378764 (ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107378764
NCBI-ProteinID: XP_015804641
UniProt: A0A1A8UWN3
Position
sgr05
AA seq 480 aa AA seqDB search
MDAAEFRRRGKEMVDYVADYLEKIEERPVYPDLEPGYLRDLIPTEAPCEPESFEDLMQDV
ERVIMPGITHWHSPNFFAYFPAASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMLD
WLGKMLQLPECFIAGTHGHGGGVIQSTASEATLMSLLAARCKAVRRVQAVESERSESDVL
SKLVAYTSDQAHSSVERAALIGAVMMRKVPTDEHFAVREEMLKKMVEEDKAAGLIPFYFC
ATLGTTPSCAFDHITKLGPLCNKENMWMHIDAAYAGSAFICPEFRPLLNGIEYADSFNFN
PHKWLLINFDCSTMWVKKRTDIIGAFKMEPLYLKHENQESGLVTDYRHWQIPLGRRFRSL
KMWFVFRLYGLKGLQAHIRKQVALAKEFESLVQADNRFEICAEVILGLVCFRLKGSNELN
QNLLKRITKSREIHLVPCQLSGRFVLRFAICARTTESRHIQRAWRHITQLAFELLQEQPH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcagaatttcggcgcagaggcaaagagatggttgactacgtggctgactat
ttggaaaaaatagaggaacgaccagtctacccagacctggaaccaggatatctgcgtgat
ttaatcccgactgaagccccatgtgagcctgagagttttgaggatctaatgcaagatgta
gagagagtcataatgccagggattacccattggcacagccccaacttttttgcctacttt
ccagcagcttcgtcctaccctgctatgctggctgatatgttgtgtggagccattggatgt
attggattttcctgggctgccagccccgcctgcactgagctggagacggtgatgctggat
tggctcggaaagatgctgcaactgcccgagtgttttatagctgggactcatggtcatgga
ggaggtgtcattcagagcacagccagtgaggcgactctgatgtccctccttgctgctcgc
tgtaaagccgtcagacgagtccaggctgtggaatctgaaaggtccgagtccgacgtcctc
tccaagctggtggcatacacttctgaccaagctcattcgtctgttgagcgtgctgctctg
atcggagcagtgatgatgaggaaggttcccacagatgaacattttgctgtcagggaggaa
atgctgaagaagatggtggaggaggacaaagcagctggactcatccctttttatttttgt
gcaacacttggcaccactccatcatgtgcgtttgatcacatcaccaagctggggcccctg
tgtaataaggaaaatatgtggatgcacattgatgcagcttatgctgggagtgcctttatt
tgtcctgagtttagacctctcctgaacggcattgagtacgcagattctttcaactttaac
ccccacaaatggcttctgattaactttgactgctccacaatgtgggtgaagaagaggacg
gacatcattggagcctttaaaatggaaccgctctacctgaagcatgaaaaccaggagtca
ggtcttgtcacagactacaggcactggcagattcctctgggaagaagatttcgctcactg
aagatgtggtttgtatttcgtttgtacggactgaaagggctgcaagctcatatacgaaag
caagtggccctggccaaagagttcgagagcctggttcaagcagacaaccggtttgagatc
tgtgctgaggtcatcttaggactggtctgcttcaggctcaagggctccaatgagctgaac
cagaacctgctgaagaggatcacaaagagcagagaaatccacctggtgccctgccagctg
tctggccgctttgtccttcgctttgccatctgtgcacgcaccaccgagtcacgccacatc
caacgagcatggcgtcacatcacacaacttgcttttgagcttttgcaggagcagccacat
tga

DBGET integrated database retrieval system