KEGG   Nothobranchius furzeri (turquoise killifish): 107379589Help
Entry
107379589         CDS       T05163                                 

Gene name
gba
Definition
(RefSeq) glucosylceramidase isoform X1
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00511  Other glycan degradation
nfu00600  Sphingolipid metabolism
nfu01100  Metabolic pathways
nfu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107379589 (gba)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107379589 (gba)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107379589 (gba)
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107379589 (gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 107379589
NCBI-ProteinID: XP_015805884
UniProt: A0A1A8VEJ5
Position
sgr05
AA seq 522 aa AA seqDB search
MVRSWTSGLLLLLVLLSAGVLSCAGSSKCVGRDFGYGSVVCECNSTYCDSVGPVTLPPLG
QYSTYLSSMAGSRLEVGQGQVQVNSSGAALRLTIRSEQKYQKIRGFGGAMTDAAAINILS
LSAGAQEQLLRQYFSSEGIGYSVVRVPMASCDFSTRLYTYADTPGDYNLDSFALASEDTD
MKIPLLQRAQAMSPQPLSLLASAWSAPAWMKTNNALTGKGSLKGKPGGKEHKTWAQYYIR
FLQEYAKYNLTFWALTTGNEPSAGLLTNYSFQALGFTPWEQKDWVAMDLGPAVHSSSFPH
THILILDDNRLLLPFWAKVVLDDVHAGRYVHGVGVHWYYDNLVPAAISLGATHKLYPEYY
LFGTEACAGWNPLDRGVKLGSWARAEAYAHDIMEDLNNYVVGWTDWNLALDQTGGPNWVK
NFVDSPVIVDVTSDVFYKQPTFYSMAHFSKFLWAGSQRVGVTANKATRLEYTAFVRPDGS
VVLIVLNRSSSPIQLEVQDPTVGNIPCSAPAHSLLTLAWNTH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgttcatggacatcaggtttacttctgctgcttgttttgctgtcggcaggagtc
ctctcctgcgcaggcagcagtaaatgtgtcggcagggactttggctatggctctgtggtg
tgtgagtgtaactctacctactgcgacagtgttggcccggtcactctgccccctctgggt
cagtactccacatatctgagcagcatggcaggcagcaggctggaggtgggtcagggtcag
gtccaggtgaacagctctggagcagctctcaggttgacgatcagaagcgaacagaagtat
cagaagatcagggggttcggtggagccatgaccgatgcagcagccatcaacatcctctca
ctttctgctggagcgcaggagcagctgctgcgacagtacttctccagcgaaggcatcggc
tacagcgttgtgcgtgtccccatggccagctgtgacttctccactcgcctctacacctac
gccgacacacccggggactacaacctggacagcttcgctttggcctcagaggacacggac
atgaagatccctcttctgcagcgagcccaggccatgtctcctcagcctctgtctctcctg
gccagtgcctggagcgcccccgcctggatgaaaactaacaatgccctcacaggaaaaggc
tccctgaagggcaaacctggaggcaaggagcacaaaacatgggctcaatactacatcagg
ttcctccaggaatatgccaaatataacttaaccttctgggccctgactacaggaaatgag
ccctctgcaggacttctaacaaactacagctttcaggctctgggcttcactccttgggag
cagaaggactgggtcgctatggatttgggccccgcagtgcattcctcatcattcccccac
acacacatcctcattctggatgacaaccgtctgctgctgcccttctgggccaaagtggtt
ctagatgacgttcacgccgggcgctatgttcatggtgtgggagtccactggtactatgac
aatttggtccctgcagcgataagtctgggcgccacccataagctctacccagagtattac
ctgttcggcaccgaggcctgtgctggctggaacccactagacagaggagtgaagctgggg
agctgggcgagggcggaggcgtacgcacacgacatcatggaggacctaaataactatgtt
gtgggttggacggactggaacctggcgttggaccagaccggtggaccaaactgggtcaag
aactttgtggacagcccagtcatagtggacgtaacgagtgacgtcttttacaagcagccg
accttctacagcatggcccacttcagcaagttcctgtgggcggggtcacagagggtcggg
gtgacggccaacaaagccacgaggctggaatacaccgctttcgtcagaccagacggatcg
gtggtgctcatcgtactcaacaggtcctcgtccccgatccagctggaagtccaggatccg
accgtggggaacattccctgctccgctccggctcactcgctgctcacgctggcctggaac
acacactga

DBGET integrated database retrieval system